KEGG   Homo sapiens (human): 3694Help
Entry
3694              CDS       T01001                                 

Gene name
ITGB6
Definition
integrin, beta 6
Orthology
K06589  
integrin beta 6
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24.2
AA seq 788 aa AA seqDB search
MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCD
TPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEK
PVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVT
VNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCA
CHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGGNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCG
KCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEE
DFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLSTDC
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggggattgaactgctttgcctgttctttctatttctaggaaggaatgatcacgtacaa
ggtggctgtgccctgggaggtgcagaaacctgtgaagactgcctgcttattggacctcag
tgtgcctggtgtgctcaggagaattttactcatccatctggagttggcgaaaggtgtgat
accccagcaaaccttttagctaaaggatgtcaattaaacttcatcgaaaaccctgtctcc
caagtagaaatacttaaaaataagcctctcagtgtaggcagacagaaaaatagttctgac
attgttcagattgcgcctcaaagcttgatccttaagttgagaccaggtggtgcgcagact
ctgcaggtgcatgtccgccagactgaggactacccggtggatttgtattacctcatggac
ctctccgcctccatggatgacgacctcaacacaataaaggagctgggctcccggctttcc
aaagagatgtctaaattaaccagcaactttagactgggcttcggatcttttgtggaaaaa
cctgtatccccttttgtgaaaacaacaccagaagaaattgccaacccttgcagtagtatt
ccatacttctgtttacctacatttggattcaagcacattttgccattgacaaatgatgct
gaaagattcaatgaaattgtgaagaatcagaaaatttctgctaatattgacacacccgaa
ggtggatttgatgcaattatgcaagctgctgtgtgtaaggaaaaaattggctggcggaat
gactccctccacctcctggtctttgtgagtgatgctgattctcattttggaatggacagc
aaactagcaggcatcgtcattcctaatgacgggctctgtcacttggacagcaagaatgaa
tactccatgtcaactgtcttggaatatccaacaattggacaactcattgataaactggta
caaaacaacgtgttattgatcttcgctgtaacccaagaacaagttcatttatatgagaat
tacgcaaaacttattcctggagctacagtaggtctacttcagaaggactccggaaacatt
ctccagctgatcatctcagcttatgaagaactgcggtctgaggtggaactggaagtatta
ggagacactgaaggactcaacttgtcatttacagccatctgtaacaacggtaccctcttc
caacaccaaaagaaatgctctcacatgaaagtgggagacacagcttccttcagcgtgact
gtgaatatcccacactgcgagagaagaagcaggcacattatcataaagcctgtggggctg
ggggatgccctggaattacttgtcagcccagaatgcaactgcgactgtcagaaagaagtg
gaagtgaacagctccaaatgtcaccacgggaacggctctttccagtgtggggtgtgtgcc
tgccaccctggccacatggggcctcgctgtgagtgtggcgaggacatgctgagcacagat
tcctgcaaggaggccccagatcatccctcctgcagcggaaggggtgactgctactgtggg
cagtgtatctgccacttgtctccctatggaaacatttatgggccttattgccagtgtgac
aatttctcctgcgtgagacacaaagggctgctctgcggaggtaacggcgactgtgactgt
ggtgaatgtgtgtgcaggagcggctggactggcgagtactgcaactgcaccaccagcacg
gactcctgcgtctctgaagatggagtgctctgcagcgggcgcggggactgtgtttgtggc
aagtgtgtttgcacaaaccctggagcctcaggaccaacctgtgaacgatgtcctacctgt
ggtgacccctgtaactctaaacggagctgcattgagtgccacctgtcagcagctggccaa
gcccgagaagaatgtgtggacaagtgcaaactagctggtgcgaccatcagtgaagaagaa
gatttctcaaaggatggttctgtttcctgctctctgcaaggagaaaatgaatgtcttatt
acattcctaataactacagataatgaggggaaaaccatcattcacagcatcaatgaaaaa
gattgtccgaagcctccaaacattcccatgatcatgttaggggtttccctggctattctt
ctcatcggggttgtcctactgtgcatctggaagctactggtgtcatttcatgatcgtaaa
gaagttgccaaatttgaagcagaacgatcaaaagccaagtggcaaacgggaaccaatcca
ctctacagaggatccacaagtacttttaaaaatgtaacttataaacacagggaaaaacaa
aaggtagacctttccacagattgctag

DBGET integrated database retrieval system