KEGG   Homo sapiens (human): 3700Help
Entry
3700              CDS       T01001                                 

Gene name
ITIH4, GP120, H4P, IHRP, ITI-HC4, ITIHL1, PK-120, PK120
Definition
inter-alpha-trypsin inhibitor heavy chain family, member 4
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.1
AA seq 900 aa AA seqDB search
MKPPRPVRTCSKVLVLLSLLAIHQTTTAEKNGIDIYSLTVDSRVSSRFAHTVVTSRVVNR
ANTVQEATFQMELPKKAFITNFSMIIDGMTYPGIIKEKAEAQAQYSAAVAKGKSAGLVKA
TGRNMEQFQVSVSVAPNAKITFELVYEELLKRRLGVYELLLKVRPQQLVKHLQMDIHIFE
PQGISFLETESTFMTNQLVDALTTWQNKTKAHIRFKPTLSQQQKSPEQQETVLDGNLIIR
YDVDRAISGGSIQIENGYFVHYFAPEGLTTMPKNVVFVIDKSGSMSGRKIQQTREALIKI
LDDLSPRDQFNLIVFSTEATQWRPSLVPASAENVNKARSFAAGIQALGGTNINDAMLMAV
QLLDSSNQEERLPEGSVSLIILLTDGDPTVGETNPRSIQNNVREAVSGRYSLFCLGFGFD
VSYAFLEKLALDNGGLARRIHEDSDSALQLQDFYQEVANPLLTAVTFEYPSNAVEEVTQN
NFRLLFKGSEMVVAGKLQDRGPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPKYIF
HNFMERLWAYLTIQQLLEQTVSASDADQQALRNQALNLSLAYSFVTPLTSMVVTKPDDQE
QSQVAEKPMEGESRNRNVHSAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRL
AILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDP
RHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSS
AYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSH
VGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccccaaggcctgtccgtacctgcagcaaagttctcgtcctgctttcactgctg
gccatccaccagactactactgccgaaaagaatggcatcgacatctacagcctcaccgtg
gactccagggtctcatcccgatttgcccacacggtcgtcaccagccgagtggtcaatagg
gccaatactgtgcaggaggccaccttccagatggagctgcccaagaaagccttcatcacc
aacttctccatgatcatcgatggcatgacctacccagggatcatcaaggagaaggctgaa
gcccaggcacagtacagcgcagcagtggccaagggaaagagcgctggcctcgtcaaggcc
accgggagaaacatggagcagttccaggtgtcggtcagtgtggctcccaatgccaagatc
acctttgagctggtctatgaggagctgctcaagcggcgtttgggggtgtacgagctgctg
ctgaaagtgcggccccagcagctggtcaagcacctgcagatggacattcacatcttcgag
ccccagggcatcagctttctggagacagagagcaccttcatgaccaaccagctggtagac
gccctcaccacctggcagaataagaccaaggctcacatccggttcaagccaacactttcc
cagcagcaaaagtccccagagcagcaagaaacagtcctggacggcaacctcattatccgc
tatgatgtggaccgggccatctccgggggctccattcagatcgagaacggctactttgta
cactactttgcccccgagggcctaaccacaatgcccaagaatgtggtctttgtcattgac
aagagcggctccatgagtggcaggaaaatccagcagacccgggaagccctaatcaagatc
ctggatgacctcagccccagagaccagttcaacctcatcgtcttcagtacagaagcaact
cagtggaggccatcactggtgccagcctcagccgagaacgtgaacaaggccaggagcttt
gctgcgggcatccaggccctgggagggaccaacatcaatgatgcaatgctgatggctgtg
cagttgctggacagcagcaaccaggaggagcggctgcccgaagggagtgtctcactcatc
atcctgctcaccgatggcgaccccactgtgggggagactaaccccaggagcatccagaat
aacgtgcgggaagctgtaagtggccggtacagcctcttctgcctgggcttcggtttcgac
gtcagctatgccttcctggagaagctggcactggacaatggcggcctggcccggcgcatc
catgaggactcagactctgccctgcagctccaggacttctaccaggaagtggccaaccca
ctgctgacagcagtgaccttcgagtacccaagcaatgccgtggaggaggtcactcagaac
aacttccggctcctcttcaagggctcagagatggtggtggctgggaagctccaggaccgg
gggcctgatgtgctcacagccacagtcagtgggaagctgcctacacagaacatcactttc
caaacggagtccagtgtggcagagcaggaggcggagttccagagccccaagtatatcttc
cacaacttcatggagaggctctgggcatacctgactatccagcagctgctggagcaaact
gtctccgcatccgatgctgatcagcaggccctccggaaccaagcgctgaatttatcactt
gcctacagctttgtcacgcctctcacatctatggtagtcaccaaacccgatgaccaagag
cagtctcaagttgctgagaagcccatggaaggcgaaagtagaaacaggaatgtccactca
gctggagctgctggctcccggatgaatttcagacctggggttctcagctccaggcaactt
ggactcccaggacctcctgatgttcctgaccatgctgcttaccaccccttccgccgtctg
gccatcttgcctgcttcagcaccaccagccacctcaaatcctgatccagctgtgtctcgt
gtcatgaatatgaaaatcgaagaaacaaccatgacaacccaaaccccagcccccatacag
gctccctctgccatcctgccactgcctgggcagagtgtggagcggctctgtgtggacccc
agacaccgccaggggccagtgaacctgctctcagaccctgagcaaggggttgaggtgact
ggccagtatgagagggagaaggctgggttctcatggatcgaagtgaccttcaagaacccc
ctggtatgggttcacgcatcccctgaacacgtggtggtgactcggaaccgaagaagctct
gcgtacaagtggaaggagacgctattctcagtgatgcccggcctgaagatgaccatggac
aagacgggtctcctgctgctcagtgacccagacaaagtgaccatcggcctgttgttctgg
gatggccgtggggaggggctccggctccttctgcgtgacactgaccgcttctccagccac
gttggagggacccttggccagttttaccaggaggtgctctggggatctccagcagcatca
gatgacggcagacgcacgctgagggttcagggcaatgaccactctgccaccagagagcgc
aggctggattaccaggaggggcccccgggagtggagatttcctgctggtctgtggagctg
tag

DBGET integrated database retrieval system