KEGG   Homo sapiens (human): 3702Help
Entry
3702              CDS       T01001                                 

Gene name
ITK, EMT, LPFS1, LYK, PSCTK2
Definition
IL2-inducible T-cell kinase (EC:2.7.10.2)
Orthology
K07363  
IL2-inducible T-cell kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
T cell receptor signaling pathway
Leukocyte transendothelial migration
Disease
H00107  
Other well-defined immunodeficiency syndromes
Class
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31-q32
AA seq 620 aa AA seqDB search
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALY
DYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTKAVVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE
DRPAFSRLLRQLAEIAESGL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactttatcctcctggaagaacagctcatcaagaaatcccaacaaaagagaaga
acttctccctcgaactttaaagtccgcttctttgtgttaaccaaagccagcctggcatac
tttgaagatcgtcatgggaagaagcgcacgctgaaggggtccattgagctctcccgaatc
aaatgtgttgagattgtgaaaagtgacatcagcatcccatgccactataaatacccgttt
caggtggtgcatgacaactacctcctatatgtgtttgctccagatcgtgagagccggcag
cgctgggtgctggcccttaaagaagaaacgaggaataataacagtttggtgcctaaatat
catcctaatttctggatggatgggaagtggaggtgctgttctcagctggagaagcttgca
acaggctgtgcccaatatgatccaaccaagaatgcttcaaagaagcctcttcctcctact
cctgaagacaacaggcgaccactttgggaacctgaagaaactgtggtcattgccttatat
gactaccaaaccaatgatcctcaggaactcgcactgcggcgcaacgaagagtactgcctg
ctggacagttctgagattcactggtggagagtccaggacaggaatgggcatgaaggatat
gtaccaagcagttatctggtggaaaaatctccaaataatctggaaacctatgagtggtac
aataagagtatcagccgagacaaagctgaaaaacttcttttggacacaggcaaagaagga
gccttcatggtaagggattccaggactgcaggaacatacaccgtgtctgttttcaccaag
gctgttgtaagtgagaacaatccctgtataaagcattatcacatcaaggaaacaaatgac
aatcctaagcgatactatgtggctgaaaagtatgtgttcgattccatccctcttctcatc
aactatcaccaacataatggaggaggcctggtgactcgactccggtatccagtttgtttt
gggaggcagaaagccccagttacagcagggctgagatacgggaaatgggtgatcgacccc
tcagagctcacttttgtgcaagagattggcagtgggcaatttgggttggtgcatctgggc
tactggctcaacaaggacaaggtggctatcaaaaccattcgggaaggggctatgtcagaa
gaggacttcatagaggaggctgaagtaatgatgaaactctctcatcccaaactggtgcag
ctgtatggggtgtgcctggagcaggcccccatctgcctggtgtttgagttcatggagcac
ggctgcctgtcagattatctacgcacccagcggggactttttgctgcagagaccctgctg
ggcatgtgtctggatgtgtgtgagggcatggcctacctggaagaggcatgtgtcatccac
agagacttggctgccagaaattgtttggtgggagaaaaccaagtcatcaaggtgtctgac
tttgggatgacaaggttcgttctggatgatcagtacaccagttccacaggcaccaaattc
ccggtgaagtgggcatccccagaggttttctctttcagtcgctatagcagcaagtccgat
gtgtggtcatttggtgtgctgatgtgggaagttttcagtgaaggcaaaatcccgtatgaa
aaccgaagcaactcagaggtggtggaagacatcagtaccggatttcggttgtacaagccc
cggctggcctccacacacgtctaccagattatgaatcactgctggaaagagagaccagaa
gatcggccagccttctccagactgctgcgtcaactggctgaaattgcagaatcaggactt
tag

DBGET integrated database retrieval system