KEGG   Homo sapiens (human): 3705Help
Entry
3705              CDS       T01001                                 

Gene name
ITPK1, ITRPK1
Definition
inositol-tetrakisphosphate 1-kinase (EC:2.7.1.134 2.7.1.159)
Orthology
K00913  
inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3705 (ITPK1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    3705 (ITPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     3705 (ITPK1)
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     3705 (ITPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q31
AA seq 414 aa AA seqDB search
MQTFLKGKRVGYWLSEKKIKKLNFQAFAELCRKRGMEVVQLNLSRPIEEQGPLDVIIHKL
TDVILEADQNDSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYM
EDDRICSPPFMELTSLCGDDTMRLLEKNGLTFPFICKTRVAHGTNSHEMAIVFNQEGLNA
IQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHNVSKPES
SSVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDINAFP
GYEGVSEFFTDLLNHIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLVGERTCSASPG
CCGSMMGQDAPWKAEADAGGTAKLPHQRLGCNAGVSPSFQQHCVASLATKASSQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctttctgaaagggaagagagttggctactggctgagcgagaagaaaatcaag
aagctgaatttccaggccttcgccgagctgtgcaggaagcgagggatggaggttgtgcag
ctgaaccttagccggccgatcgaggagcagggccccctggacgtcatcatccacaagctg
actgacgtcatccttgaagccgaccagaatgatagccagtccctggagctggtgcacagg
ttccaggagtacatcgatgcccaccctgagaccatcgtcctggacccgctccctgccatc
agaaccctgcttgaccgctccaagtcctatgagctcatccggaagattgaggcctacatg
gaagacgacaggatctgctcgccacccttcatggagctcacgagcctgtgcggggatgac
accatgcggctgctggagaagaacggcttgactttcccattcatttgcaaaaccagagtg
gctcatggcaccaactctcacgagatggctatcgtgttcaaccaggagggcctgaacgcc
atccagccaccctgcgtggtccagaatttcatcaaccacaacgccgtcctgtacaaggtg
ttcgtggttggcgagtcctacaccgtggtccagaggccctcactcaagaacttctccgca
ggcacatcagaccgtgagtccatcttcttcaacagccacaacgtgtcaaagccggagtcg
tcatcggtcctgacggagctggacaagatcgagggcgtgttcgagcggccgagcgacgag
gtcatccgggagctctcccgggccctgcggcaggcactgggcgtgtcactcttcggcatc
gacatcatcatcaacaaccagacagggcagcacgccgtcattgacatcaatgccttccca
ggctacgagggcgtgagcgagttcttcacagacctcctgaaccacatcgccactgtcctg
cagggccagagcacagccatggcagccacaggggacgtggccctgctgaggcacagcaag
cttctggccgagccggcgggcggcctggtgggcgagcggacatgcagcgccagccccggc
tgctgcggcagcatgatgggccaggacgcgccctggaaggctgaggccgacgcgggcggc
accgccaagctgccgcaccagagactcggctgcaacgccggcgtgtcgcccagcttccag
cagcattgtgtggcctccctggccaccaaggcctcctcccagtag

DBGET integrated database retrieval system