KEGG   Homo sapiens (human): 3705Help
Entry
3705              CDS       T01001                                 

Gene name
ITPK1, ITRPK1
Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3705 (ITPK1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    3705 (ITPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     3705 (ITPK1)
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     3705 (ITPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin RimK ATP-grasp_3
Motif
Other DBs
NCBI-GeneID: 3705
NCBI-ProteinID: NP_001136065
OMIM: 601838
HGNC: 6177
Ensembl: ENSG00000100605
Vega: OTTHUMG00000171226
Pharos: Q13572(Tbio)
UniProt: Q13572 A0A024R6H3
Structure
PDB: 

Jmol
Position
14q32.12
AA seq 414 aa AA seqDB search
MQTFLKGKRVGYWLSEKKIKKLNFQAFAELCRKRGMEVVQLNLSRPIEEQGPLDVIIHKL
TDVILEADQNDSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYM
EDDRICSPPFMELTSLCGDDTMRLLEKNGLTFPFICKTRVAHGTNSHEMAIVFNQEGLNA
IQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHNVSKPES
SSVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDINAFP
GYEGVSEFFTDLLNHIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLVGERTCSASPG
CCGSMMGQDAPWKAEADAGGTAKLPHQRLGCNAGVSPSFQQHCVASLATKASSQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctttctgaaagggaagagagttggctactggctgagcgagaagaaaatcaag
aagctgaatttccaggccttcgccgagctgtgcaggaagcgagggatggaggttgtgcag
ctgaaccttagccggccgatcgaggagcagggccccctggacgtcatcatccacaagctg
actgacgtcatccttgaagccgaccagaatgatagccagtccctggagctggtgcacagg
ttccaggagtacatcgatgcccaccctgagaccatcgtcctggacccgctccctgccatc
agaaccctgcttgaccgctccaagtcctatgagctcatccggaagattgaggcctacatg
gaagacgacaggatctgctcgccacccttcatggagctcacgagcctgtgcggggatgac
accatgcggctgctggagaagaacggcttgactttcccattcatttgcaaaaccagagtg
gctcatggcaccaactctcacgagatggctatcgtgttcaaccaggagggcctgaacgcc
atccagccaccctgcgtggtccagaatttcatcaaccacaacgccgtcctgtacaaggtg
ttcgtggttggcgagtcctacaccgtggtccagaggccctcactcaagaacttctccgca
ggcacatcagaccgtgagtccatcttcttcaacagccacaacgtgtcaaagccggagtcg
tcatcggtcctgacggagctggacaagatcgagggcgtgttcgagcggccgagcgacgag
gtcatccgggagctctcccgggccctgcggcaggcactgggcgtgtcactcttcggcatc
gacatcatcatcaacaaccagacagggcagcacgccgtcattgacatcaatgccttccca
ggctacgagggcgtgagcgagttcttcacagacctcctgaaccacatcgccactgtcctg
cagggccagagcacagccatggcagccacaggggacgtggccctgctgaggcacagcaag
cttctggccgagccggcgggcggcctggtgggcgagcggacatgcagcgccagccccggc
tgctgcggcagcatgatgggccaggacgcgccctggaaggctgaggccgacgcgggcggc
accgccaagctgccgcaccagagactcggctgcaacgccggcgtgtcgcccagcttccag
cagcattgtgtggcctccctggccaccaaggcctcctcccagtag

DBGET integrated database retrieval system