KEGG   Homo sapiens (human): 3706Help
Entry
3706              CDS       T01001                                 

Gene name
ITPKA, IP3-3KA, IP3KA
Definition
inositol-trisphosphate 3-kinase A (EC:2.7.1.127)
Orthology
K00911  
1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    3706 (ITPKA)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    3706 (ITPKA)
   04070 Phosphatidylinositol signaling system
    3706 (ITPKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     3706 (ITPKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q15.1
AA seq 461 aa AA seqDB search
MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAK
RRGGQVPNGLPRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRL
STSSVSSTGSSSLLEDSEDDLLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVIS
PFKKRYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYCLARLMADALRGCVPAFHGVVER
DGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAP
TEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFE
EFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT
TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcccgggggcccaacgggcatggcgcggccggggggcgcgaggccctgcagc
ccggggctggagcgggccccgcgccggagtgtcggggagctgcgcctgctcttcgaggcg
cgctgtgcggcggtcgctgcggccgccgccgcgggggagccccgggcccgcggggccaag
cggcgtgggggacaggtccccaacgggcttccgcgggctcccccggccccggtgatccct
cagctgaccgtgacagccgaggagcccgacgtgcccccgaccagccctgggccgccggag
cgggagagggactgcctcccggcagcgggctcttcgcacctgcagcagccgcgccgcctt
tccacctcgtcggtctcctccactggctcctcgtcgctgctcgaggactcggaggacgac
ctgctgagcgacagtgagagccggagccgcggcaacgtgcagctggaagcgggcgaggac
gtgggtcagaaaaaccactggcagaagatccggaccatggtcaatctgccggtcataagc
cctttcaagaagcgctacgcctgggtgcagctggcagggcacactgggagttttaaggcg
gcgggcaccagcgggctgatcctgaagcgctgctcggagccggagcgctactgcctggcg
cggctgatggctgacgcgctgcgcggctgcgtgcctgccttccacggcgtggtggagcgc
gacggcgaaagctacctgcagctgcaggacctgctcgatggcttcgacggaccttgtgtg
ctcgactgcaaaatgggcgtcaggacttacctagaggaggagctgaccaaggcccgtgag
cggcccaagctgcggaaggacatgtacaagaaaatgctggcggtggatcctgaagctccc
acggaggaggagcacgcgcagcgcgccgtcaccaagccgcgctacatgcagtggcgggaa
ggcatcagctccagcaccaccctcggcttccgcatcgagggcatcaagaaagcggacggc
tcctgcagcaccgacttcaagactacgcgaagccgagagcaggtgcttcgcgtctttgaa
gagtttgtgcaaggagatgaggaagtgctgaggcggtatctgaaccgcctgcagcagatc
cgggacaccctggaggtatccgagttcttcaggaggcacgaggtgatcggcagctcgctc
ctctttgtgcacgatcactgccatcgcgccggcgtgtggctcatcgacttcggcaagacc
acgcccctccccgatggccagatcctggaccaccggcggccctgggaggagggcaaccgc
gaggacggctatttgctggggctggacaatctcattggcatcctggccagcctggctgag
agatga

DBGET integrated database retrieval system