KEGG   Homo sapiens (human): 3714Help
Entry
3714              CDS       T01001                                 

Gene name
JAG2, HJ2, SER2
Definition
(RefSeq) jagged 2
  KO
K21635  
jagged-2
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Notch signaling pathway
Th1 and Th2 cell differentiation
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    3714 (JAG2)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    3714 (JAG2)
 Human Diseases
  Cancers
   05224 Breast cancer
    3714 (JAG2)
  Drug resistance
   01522 Endocrine resistance
    3714 (JAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y219(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.33
AA seq 1238 aa AA seqDB search
MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARAR
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKEC
KEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWG
GLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGG
SCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVN
GYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLC
EPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGT
AASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRC
FCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYT
CSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDG
WEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGA
TCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRD
CSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCL
PRSGHLDNNCARLTLHFNRDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSG
ASAVEVAVSFSPARDLPDSSLIQGAAHAIVAAITQRGNSSLLLAVTEVKVETVVTGGSST
GLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRLPREESANNQWAPLNPIRNPIER
PGGHKDVLYQCKNFTPPPRRADEALPGPAGHAAVREDEEDEDLGRGEEDSLEAEKFLSHK
FTKDPGRSPGRPAHWASGPKVDNRAVRSINEARYAGKE
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgcagggccgggggcgccttccccggcggctgctgctgctgctggcgctctgg
gtgcaggcggcgcggcccatgggctatttcgagctgcagctgagcgcgctgcggaacgtg
aacggggagctgctgagcggcgcctgctgtgacggcgacggccggacaacgcgcgcgggg
ggctgcggccacgacgagtgcgacacgtacgtgcgcgtgtgccttaaggagtaccaggcc
aaggtgacgcccacggggccctgcagctacggccacggcgccacgcccgtgctgggcggc
aactccttctacctgccgccggcgggcgctgcgggggaccgagcgcgggcgcgggcccgg
gccggcggcgaccaggacccgggcctcgtcgtcatccccttccagttcgcctggccgcgc
tcctttaccctcatcgtggaggcctgggactgggacaacgataccaccccgaatgaggag
ctgctgatcgagcgagtgtcgcatgccggcatgatcaacccggaggaccgctggaagagc
ctgcacttcagcggccacgtggcgcacctggagctgcagatccgcgtgcgctgcgacgag
aactactacagcgccacttgcaacaagttctgccggccccgcaacgactttttcggccac
tacacctgcgaccagtacggcaacaaggcctgcatggacggctggatgggcaaggagtgc
aaggaagctgtgtgtaaacaagggtgtaatttgctccacgggggatgcaccgtgcctggg
gagtgcaggtgcagctacggctggcaagggaggttctgcgatgagtgtgtcccctacccc
ggctgcgtgcatggcagttgtgtggagccctggcagtgcaactgtgagaccaactggggc
ggcctgctctgtgacaaagacctgaactactgtggcagccaccacccctgcaccaacgga
ggcacgtgcatcaacgccgagcctgaccagtaccgctgcacctgccctgacggctactcg
ggcaggaactgtgagaaggctgagcacgcctgcacctccaacccgtgtgccaacgggggc
tcttgccatgaggtgccgtccggcttcgaatgccactgcccatcgggctggagcgggccc
acctgtgcccttgacatcgatgagtgtgcttcgaacccgtgtgcggccggtggcacctgt
gtggaccaggtggacggctttgagtgcatctgccccgagcagtgggtgggggccacctgc
cagctggacgccaatgagtgtgaagggaagccatgccttaacgctttttcttgcaaaaac
ctgattggcggctattactgtgattgcatcccgggctggaagggcatcaactgccatatc
aacgtcaacgactgtcgcgggcagtgtcagcatgggggcacctgcaaggacctggtgaac
gggtaccagtgtgtgtgcccacggggcttcggaggccggcattgcgagctggaacgagac
gagtgtgccagcagcccctgccacagcggcggcctctgcgaggacctggccgacggcttc
cactgccactgcccccagggcttctccgggcctctctgtgaggtggatgtcgacctttgt
gagccaagcccctgccggaacggcgctcgctgctataacctggagggtgactattactgc
gcctgccctgatgactttggtggcaagaactgctccgtgccccgcgagccgtgccctggc
ggggcctgcagagtgatcgatggctgcgggtcagacgcggggcctgggatgcctggcaca
gcagcctccggcgtgtgtggcccccatggacgctgcgtcagccagccagggggcaacttt
tcctgcatctgtgacagtggctttactggcacctactgccatgagaacattgacgactgc
ctgggccagccctgccgcaatgggggcacatgcatcgatgaggtggacgccttccgctgc
ttctgccccagcggctgggagggcgagctctgcgacaccaatcccaacgactgccttccc
gatccctgccacagccgcggccgctgctacgacctggtcaatgacttctactgtgcgtgc
gacgacggctggaagggcaagacctgccactcacgcgagttccagtgcgatgcctacacc
tgcagcaacggtggcacctgctacgacagcggcgacaccttccgctgcgcctgccccccc
ggctggaagggcagcacctgcgccgtcgccaagaacagcagctgcctgcccaacccctgt
gtgaatggtggcacctgcgtgggcagcggggcctccttctcctgcatctgccgggacggc
tgggagggtcgtacttgcactcacaataccaacgactgcaaccctctgccttgctacaat
ggtggcatctgtgttgacggcgtcaactggttccgctgcgagtgtgcacctggcttcgcg
gggcctgactgccgcatcaacatcgacgagtgccagtcctcgccctgtgcctacggggcc
acgtgtgtggatgagatcaacgggtatcgctgtagctgcccacccggccgagccggcccc
cggtgccaggaagtgatcgggttcgggagatcctgctggtcccggggcactccgttccca
cacggaagctcctgggtggaagactgcaacagctgccgctgcctggatggccgccgtgac
tgcagcaaggtgtggtgcggatggaagccttgtctgctggccggccagcccgaggccctg
agcgcccagtgcccactggggcaaaggtgcctggagaaggccccaggccagtgtctgcga
ccaccctgtgaggcctggggggagtgcggcgcagaagagccaccgagcaccccctgcctg
ccacgctccggccacctggacaataactgtgcccgcctcaccttgcatttcaaccgtgac
cacgtgccccagggcaccacggtgggcgccatttgctccgggatccgctccctgccagcc
acaagggctgtggcacgggaccgcctgctggtgttgctttgcgaccgggcgtcctcgggg
gccagtgctgtggaggtggccgtgtccttcagccctgccagggacctgcctgacagcagc
ctgatccagggcgcggcccacgccatcgtggccgccatcacccagcgggggaacagctca
ctgctcctggctgtcaccgaggtcaaggtggagacggttgttacgggcggctcttccaca
ggtctgctggtgcctgtgctgtgtggtgccttcagcgtgctgtggctggcgtgcgtggtc
ctgtgcgtgtggtggacacgcaagcgcaggaaagagcgggagaggagccggctgccgcgg
gaggagagcgccaacaaccagtgggccccgctcaaccccatccgcaaccccattgagcgg
ccggggggccacaaggacgtgctctaccagtgcaagaacttcacgccgccgccgcgcagg
gcggacgaggcgctgcccgggccggccggccacgcggccgtcagggaggatgaggaggac
gaggatctgggccgcggtgaggaggactccctggaggcggagaagttcctctcacacaaa
ttcaccaaagatcctggccgctcgccggggaggccggcccactgggcctcaggccccaaa
gtggacaaccgcgcggtcaggagcatcaatgaggcccgctacgccggcaaggagtag

DBGET integrated database retrieval system