KEGG   Homo sapiens (human): 3714Help
Entry
3714              CDS       T01001                                 

Gene name
JAG2, HJ2, SER2
Definition
jagged 2
Orthology
K06052  
jagged
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32
AA seq 1238 aa AA seqDB search
MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARAR
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKEC
KEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWG
GLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGG
SCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVN
GYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLC
EPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGT
AASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRC
FCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYT
CSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDG
WEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGA
TCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRD
CSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCL
PRSGHLDNNCARLTLHFNRDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSG
ASAVEVAVSFSPARDLPDSSLIQGAAHAIVAAITQRGNSSLLLAVTEVKVETVVTGGSST
GLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRLPREESANNQWAPLNPIRNPIER
PGGHKDVLYQCKNFTPPPRRADEALPGPAGHAAVREDEEDEDLGRGEEDSLEAEKFLSHK
FTKDPGRSPGRPAHWASGPKVDNRAVRSINEARYAGKE
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgcagggccgggggcgccttccccggcggctgctgctgctgctggcgctctgg
gtgcaggcggcgcggcccatgggctatttcgagctgcagctgagcgcgctgcggaacgtg
aacggggagctgctgagcggcgcctgctgtgacggcgacggccggacaacgcgcgcgggg
ggctgcggccacgacgagtgcgacacgtacgtgcgcgtgtgccttaaggagtaccaggcc
aaggtgacgcccacggggccctgcagctacggccacggcgccacgcccgtgctgggcggc
aactccttctacctgccgccggcgggcgctgcgggggaccgagcgcgggcgcgggcccgg
gccggcggcgaccaggacccgggcctcgtcgtcatccccttccagttcgcctggccgcgc
tcctttaccctcatcgtggaggcctgggactgggacaacgataccaccccgaatgaggag
ctgctgatcgagcgagtgtcgcatgccggcatgatcaacccggaggaccgctggaagagc
ctgcacttcagcggccacgtggcgcacctggagctgcagatccgcgtgcgctgcgacgag
aactactacagcgccacttgcaacaagttctgccggccccgcaacgactttttcggccac
tacacctgcgaccagtacggcaacaaggcctgcatggacggctggatgggcaaggagtgc
aaggaagctgtgtgtaaacaagggtgtaatttgctccacgggggatgcaccgtgcctggg
gagtgcaggtgcagctacggctggcaagggaggttctgcgatgagtgtgtcccctacccc
ggctgcgtgcatggcagttgtgtggagccctggcagtgcaactgtgagaccaactggggc
ggcctgctctgtgacaaagacctgaactactgtggcagccaccacccctgcaccaacgga
ggcacgtgcatcaacgccgagcctgaccagtaccgctgcacctgccctgacggctactcg
ggcaggaactgtgagaaggctgagcacgcctgcacctccaacccgtgtgccaacgggggc
tcttgccatgaggtgccgtccggcttcgaatgccactgcccatcgggctggagcgggccc
acctgtgcccttgacatcgatgagtgtgcttcgaacccgtgtgcggccggtggcacctgt
gtggaccaggtggacggctttgagtgcatctgccccgagcagtgggtgggggccacctgc
cagctggacgccaatgagtgtgaagggaagccatgccttaacgctttttcttgcaaaaac
ctgattggcggctattactgtgattgcatcccgggctggaagggcatcaactgccatatc
aacgtcaacgactgtcgcgggcagtgtcagcatgggggcacctgcaaggacctggtgaac
gggtaccagtgtgtgtgcccacggggcttcggaggccggcattgcgagctggaacgagac
gagtgtgccagcagcccctgccacagcggcggcctctgcgaggacctggccgacggcttc
cactgccactgcccccagggcttctccgggcctctctgtgaggtggatgtcgacctttgt
gagccaagcccctgccggaacggcgctcgctgctataacctggagggtgactattactgc
gcctgccctgatgactttggtggcaagaactgctccgtgccccgcgagccgtgccctggc
ggggcctgcagagtgatcgatggctgcgggtcagacgcggggcctgggatgcctggcaca
gcagcctccggcgtgtgtggcccccatggacgctgcgtcagccagccagggggcaacttt
tcctgcatctgtgacagtggctttactggcacctactgccatgagaacattgacgactgc
ctgggccagccctgccgcaatgggggcacatgcatcgatgaggtggacgccttccgctgc
ttctgccccagcggctgggagggcgagctctgcgacaccaatcccaacgactgccttccc
gatccctgccacagccgcggccgctgctacgacctggtcaatgacttctactgtgcgtgc
gacgacggctggaagggcaagacctgccactcacgcgagttccagtgcgatgcctacacc
tgcagcaacggtggcacctgctacgacagcggcgacaccttccgctgcgcctgccccccc
ggctggaagggcagcacctgcgccgtcgccaagaacagcagctgcctgcccaacccctgt
gtgaatggtggcacctgcgtgggcagcggggcctccttctcctgcatctgccgggacggc
tgggagggtcgtacttgcactcacaataccaacgactgcaaccctctgccttgctacaat
ggtggcatctgtgttgacggcgtcaactggttccgctgcgagtgtgcacctggcttcgcg
gggcctgactgccgcatcaacatcgacgagtgccagtcctcgccctgtgcctacggggcc
acgtgtgtggatgagatcaacgggtatcgctgtagctgcccacccggccgagccggcccc
cggtgccaggaagtgatcgggttcgggagatcctgctggtcccggggcactccgttccca
cacggaagctcctgggtggaagactgcaacagctgccgctgcctggatggccgccgtgac
tgcagcaaggtgtggtgcggatggaagccttgtctgctggccggccagcccgaggccctg
agcgcccagtgcccactggggcaaaggtgcctggagaaggccccaggccagtgtctgcga
ccaccctgtgaggcctggggggagtgcggcgcagaagagccaccgagcaccccctgcctg
ccacgctccggccacctggacaataactgtgcccgcctcaccttgcatttcaaccgtgac
cacgtgccccagggcaccacggtgggcgccatttgctccgggatccgctccctgccagcc
acaagggctgtggcacgggaccgcctgctggtgttgctttgcgaccgggcgtcctcgggg
gccagtgctgtggaggtggccgtgtccttcagccctgccagggacctgcctgacagcagc
ctgatccagggcgcggcccacgccatcgtggccgccatcacccagcgggggaacagctca
ctgctcctggctgtcaccgaggtcaaggtggagacggttgttacgggcggctcttccaca
ggtctgctggtgcctgtgctgtgtggtgccttcagcgtgctgtggctggcgtgcgtggtc
ctgtgcgtgtggtggacacgcaagcgcaggaaagagcgggagaggagccggctgccgcgg
gaggagagcgccaacaaccagtgggccccgctcaaccccatccgcaaccccattgagcgg
ccggggggccacaaggacgtgctctaccagtgcaagaacttcacgccgccgccgcgcagg
gcggacgaggcgctgcccgggccggccggccacgcggccgtcagggaggatgaggaggac
gaggatctgggccgcggtgaggaggactccctggaggcggagaagttcctctcacacaaa
ttcaccaaagatcctggccgctcgccggggaggccggcccactgggcctcaggccccaaa
gtggacaaccgcgcggtcaggagcatcaatgaggcccgctacgccggcaaggagtag

DBGET integrated database retrieval system