KEGG   Homo sapiens (human): 372Help
Entry
372               CDS       T01001                                 

Gene name
ARCN1, COPD
Definition
(RefSeq) archain 1
  KO
K20471  
coatomer subunit delta
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    372 (ARCN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23.3
AA seq 511 aa AA seqDB search
MVLLAAAVCTKAGKAIVSRQFVEMTRTRIEGLLAAFPKLMNTGKQHTFVETESVRYVYQP
MEKLYMVLITTKNSNILEDLETLRLFSRVIPEYCRALEENEISEHCFDLIFAFDEIVALG
YRENVNLAQIRTFTEMDSHEEKVFRAVRETQEREAKAEMRRKAKELQQARRDAERQGKKA
PGFGGFGSSAVSGGSTAAMITETIIETDKPKVAPAPARPSGPSKALKLGAKGKEVDNFVD
KLKSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGM
IMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVG
VLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAP
VIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCN
IQVTKVTQVDGNSPVRFSTETTFLVDKYEIL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgttggcagcagcggtctgcacaaaagcaggaaaggctattgtttctcgacag
tttgtggaaatgacccgaactcggattgagggcttattagcagcttttccaaagctcatg
aacactggaaaacaacatacgtttgttgaaacagagagtgtaagatatgtctaccagcct
atggagaaactgtatatggtactgatcactaccaaaaacagcaacattttagaagatttg
gagaccctaaggctcttctcaagagtgatccctgaatattgccgagccttagaagagaat
gaaatatctgagcactgttttgatttgatttttgcttttgatgaaattgtcgcactggga
taccgggagaatgttaacttggcacagatcagaaccttcacagaaatggattctcatgag
gagaaggtgttcagagccgtcagagagactcaagaacgtgaagctaaggctgagatgcgt
cgtaaagcaaaggaattacaacaggcccgaagagatgcagagagacagggcaaaaaagca
ccaggatttggcggatttggcagctctgcagtatctggaggcagcacagctgccatgatc
acagagaccatcattgaaactgataaaccaaaagtggcacctgcaccagccaggccttca
ggccccagcaaggctttaaaacttggagccaaaggaaaggaagtagataactttgtggac
aaattaaaatctgaaggtgaaaccatcatgtcctctagtatgggcaagcgtacttctgaa
gcaaccaaaatgcatgctccacccattaatatggaaagtgtacatatgaagattgaagaa
aagataacattaacctgtggacgagacggaggattacagaatatggagttgcatggcatg
atcatgcttaggatctcagatgacaagtatggccgaattcgtcttcatgtggaaaatgaa
gataagaaaggggtgcagctacagacccatccaaatgtggataaaaaacttttcactgca
gagtctctaattggcctgaagaatccagagaagtcatttccagtcaacagtgacgtaggg
gtgctaaagtggagactacaaaccacagaggaatcttttattccactgacaattaattgc
tggccctcggagagtggaaatggctgtgatgtcaacatagaatatgagctacaagaagat
aatttagaactgaatgatgtggttatcaccatcccactcccgtctggtgtcggcgcgcct
gttatcggtgagatcgatggggagtatcgacatgacagtcgacgaaataccctggagtgg
tgcctgcctgtgattgatgccaaaaataagagtggcagcctggagtttagcattgctggg
cagcccaatgacttcttccctgttcaagtttcctttgtctccaagaaaaattactgtaac
atacaggttaccaaagtgacccaggtagatggaaacagccccgtcaggttttccacagag
accactttcctagtggataagtatgaaattctgtaa

DBGET integrated database retrieval system