KEGG   Homo sapiens (human): 3726Help
Entry
3726              CDS       T01001                                 

Gene name
JUNB, AP-1
Definition
(RefSeq) JunB proto-oncogene, AP-1 transcription factor subunit
  KO
K09028  transcription factor jun-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04668  TNF signaling pathway
Disease
H01463  Mycosis fungoides
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    3726 (JUNB)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    3726 (JUNB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3726 (JUNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf Jnk-SapK_ap_N ZapB MAD PspA_IM30 DUF737
Motif
Other DBs
NCBI-GeneID: 3726
NCBI-ProteinID: NP_002220
OMIM: 165161
HGNC: 6205
Ensembl: ENSG00000171223
Vega: OTTHUMG00000180373
Pharos: P17275(Tbio)
UniProt: P17275 Q5U079
Position
19p13.13
AA seq 347 aa AA seqDB search
MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP
EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP
VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtgcactaaaatggaacagcccttctaccacgacgactcatacacagctacgggatac
ggccgggcccctggtggcctctctctacacgactacaaactcctgaaaccgagcctggcg
gtcaacctggccgacccctaccggagtctcaaagcgcctggggctcgcggacccggccca
gagggcggcggtggcggcagctacttttctggtcagggctcggacaccggcgcgtctctc
aagctcgcctcttcggagctggaacgcctgattgtccccaacagcaacggcgtgatcacg
acgacgcctacacccccgggacagtacttttacccccgcgggggtggcagcggtggaggt
gcagggggcgcagggggcggcgtcaccgaggagcaggagggcttcgccgacggctttgtc
aaagccctggacgatctgcacaagatgaaccacgtgacaccccccaacgtgtccctgggc
gctaccggggggcccccggctgggcccgggggcgtctacgccggcccggagccacctccc
gtttacaccaacctcagcagctactccccagcctctgcgtcctcgggaggcgccggggct
gccgtcgggaccgggagctcgtacccgacgaccaccatcagctacctcccacacgcgccg
cccttcgccggtggccacccggcgcagctgggcttgggccgcggcgcctccaccttcaag
gaggaaccgcagaccgtgccggaggcgcgcagccgggacgccacgccgccggtgtccccc
atcaacatggaagaccaagagcgcatcaaagtggagcgcaagcggctgcggaaccggctg
gcggccaccaagtgccggaagcggaagctggagcgcatcgcgcgcctggaggacaaggtg
aagacgctcaaggccgagaacgcggggctgtcgagtaccgccggcctcctccgggagcag
gtggcccagctcaaacagaaggtcatgacccacgtcagcaacggctgtcagctgctgctt
ggggtcaagggacacgccttctga

DBGET integrated database retrieval system