KEGG   Homo sapiens (human): 3726Help
Entry
3726              CDS       T01001                                 

Gene name
JUNB, AP-1
Definition
jun B proto-oncogene
Orthology
K09028  
transcription factor jun-B
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
TNF signaling pathway
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 347 aa AA seqDB search
MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP
EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP
VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtgcactaaaatggaacagcccttctaccacgacgactcatacacagctacgggatac
ggccgggcccctggtggcctctctctacacgactacaaactcctgaaaccgagcctggcg
gtcaacctggccgacccctaccggagtctcaaagcgcctggggctcgcggacccggccca
gagggcggcggtggcggcagctacttttctggtcagggctcggacaccggcgcgtctctc
aagctcgcctcttcggagctggaacgcctgattgtccccaacagcaacggcgtgatcacg
acgacgcctacacccccgggacagtacttttacccccgcgggggtggcagcggtggaggt
gcagggggcgcagggggcggcgtcaccgaggagcaggagggcttcgccgacggctttgtc
aaagccctggacgatctgcacaagatgaaccacgtgacaccccccaacgtgtccctgggc
gctaccggggggcccccggctgggcccgggggcgtctacgccggcccggagccacctccc
gtttacaccaacctcagcagctactccccagcctctgcgtcctcgggaggcgccggggct
gccgtcgggaccgggagctcgtacccgacgaccaccatcagctacctcccacacgcgccg
cccttcgccggtggccacccggcgcagctgggcttgggccgcggcgcctccaccttcaag
gaggaaccgcagaccgtgccggaggcgcgcagccgggacgccacgccgccggtgtccccc
atcaacatggaagaccaagagcgcatcaaagtggagcgcaagcggctgcggaaccggctg
gcggccaccaagtgccggaagcggaagctggagcgcatcgcgcgcctggaggacaaggtg
aagacgctcaaggccgagaacgcggggctgtcgagtaccgccggcctcctccgggagcag
gtggcccagctcaaacagaaggtcatgacccacgtcagcaacggctgtcagctgctgctt
ggggtcaagggacacgccttctga

DBGET integrated database retrieval system