KEGG   Homo sapiens (human): 3727Help
Entry
3727              CDS       T01001                                 

Gene name
JUND, AP-1
Definition
(RefSeq) JunD proto-oncogene, AP-1 transcription factor subunit
  KO
K04449  
transcription factor jun-D
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3727 (JUND)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    3727 (JUND)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3727 (JUND)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 347 aa AA seqDB search
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacccttctacggcgatgaggcgctgagcggcctgggcggcggcgccagtggc
agcggcggcagcttcgcgtccccgggccgcttgttccccggggcgcccccgacggccgcg
gccggcagcatgatgaagaaggacgcgctgacgctgagcctgagtgagcaggtggcggca
gcgctcaagcctgcggccgcgccgcctcctacccccctgcgcgccgacggcgcccccagc
gcggcaccccccgacggcctgctcgcctctcccgacctggggctgctgaagctggcctcc
cccgagctcgagcgcctcatcatccagtccaacgggctggtcaccaccacgccgacgagc
tcacagttcctctaccccaaggtggcggccagcgaggagcaggagttcgccgagggcttc
gtcaaggccctggaggatttacacaagcagaaccagctcggcgcgggcgcggccgctgcc
gccgccgccgccgccgccggggggccctcgggcacggccacgggctccgcgccccccggc
gagctggccccggcggcggccgcgcccgaagcgcctgtctacgcgaacctgagcagctac
gcgggcggcgccgggggcgcggggggcgccgcgacggtcgccttcgctgccgaacctgtg
cccttcccgccgccgccacccccaggcgcgttggggccgccgcgcctggctgcgctcaag
gacgagccacagacggtgcccgacgtgccgagcttcggcgagagcccgccgttgtcgccc
atcgacatggacacgcaggagcgcatcaaggcggagcgcaagcggctgcgcaaccgcatc
gccgcctccaagtgccgcaagcgcaagctggagcgcatctcgcgcctggaagagaaagtg
aagaccctcaagagtcagaacacggagctggcgtccacggcgagcctgctgcgcgagcag
gtggcgcagctcaagcagaaagtcctcagccacgtcaacagcggctgccagctgctgccc
cagcaccaggtgcccgcgtactga

DBGET integrated database retrieval system