KEGG   Homo sapiens (human): 3727Help
Entry
3727              CDS       T01001                                 

Gene name
JUND, AP-1
Definition
jun D proto-oncogene
Orthology
K04449  
transcription factor jun-D
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Osteoclast differentiation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 304 aa AA seqDB search
MMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPEL
ERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAA
AAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFP
PPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAAS
KCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQ
VPAY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaaggacgcgctgacgctgagcctgagtgagcaggtggcggcagcgctcaag
cctgcggccgcgccgcctcctacccccctgcgcgccgacggcgcccccagcgcggcaccc
cccgacggcctgctcgcctctcccgacctggggctgctgaagctggcctcccccgagctc
gagcgcctcatcatccagtccaacgggctggtcaccaccacgccgacgagctcacagttc
ctctaccccaaggtggcggccagcgaggagcaggagttcgccgagggcttcgtcaaggcc
ctggaggatttacacaagcagaaccagctcggcgcgggcgcggccgctgccgccgccgcc
gccgccgccggggggccctcgggcacggccacgggctccgcgccccccggcgagctggcc
ccggcggcggccgcgcccgaagcgcctgtctacgcgaacctgagcagctacgcgggcggc
gccgggggcgcggggggcgccgcgacggtcgccttcgctgccgaacctgtgcccttcccg
ccgccgccacccccaggcgcgttggggccgccgcgcctggctgcgctcaaggacgagcca
cagacggtgcccgacgtgccgagcttcggcgagagcccgccgttgtcgcccatcgacatg
gacacgcaggagcgcatcaaggcggagcgcaagcggctgcgcaaccgcatcgccgcctcc
aagtgccgcaagcgcaagctggagcgcatctcgcgcctggaagagaaagtgaagaccctc
aagagtcagaacacggagctggcgtccacggcgagcctgctgcgcgagcaggtggcgcag
ctcaagcagaaagtcctcagccacgtcaacagcggctgccagctgctgccccagcaccag
gtgcccgcgtactga

DBGET integrated database retrieval system