KEGG   Homo sapiens (human): 3728Help
Entry
3728              CDS       T01001                                 

Gene name
JUP, ARVD12, CTNNG, DP3, DPIII, PDGB, PKGB
Definition
(RefSeq) junction plakoglobin
  KO
K10056  
junction plakoglobin
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Disease
H00293  
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
H00669  
Naxos disease and Carvajal syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3728 (JUP)
   05202 Transcriptional misregulation in cancers
    3728 (JUP)
   05221 Acute myeloid leukemia
    3728 (JUP)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3728 (JUP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3728 (JUP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21
AA seq 745 aa AA seqDB search
MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTT
YTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDM
DGDYPIDTYSDGLRPPYPTADHMLA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgatgaacctgatggagcagcctatcaaggtgactgagtggcagcagacatac
acctacgactcgggtatccactcgggcgccaacacctgcgtgccctccgtcagcagcaag
ggcatcatggaggaggatgaggcctgcgggcgccagtacacgctcaagaaaaccaccact
tacacccagggggtgccccccagccaaggtgatctggagtaccagatgtccacaacagcc
agggccaaacgggtgcgggaggccatgtgccctggtgtgtcaggcgaggacagctcgctt
ctgctggccacccaggtggaggggcaggccaccaacctgcagcgactggccgagccgtcc
cagctgctcaagtcggccattgtgcatctcatcaactaccaggacgatgccgagctggcc
actcgcgccctgcccgagctcaccaaactgctcaacgacgaggacccggtggtggtgacc
aaggcggccatgattgtgaaccagctgtcgaagaaggaggcgtcgcggcgggccctgatg
ggctcgccccagctggtggccgctgtcgtgcgtaccatgcagaataccagcgacctggac
acagcccgctgcaccaccagcatcctgcacaacctctcccaccaccgggaggggctgctc
gccatcttcaagtcgggtggcatccctgctctggtccgcatgctcagctcccctgtggag
tcggtcctgttctatgccatcaccacgctgcacaacctgctcctgtaccaggagggcgcc
aagatggccgtgcgcctggccgacgggctgcaaaagatggtgcccctgctcaacaagaac
aaccccaagttcctggccatcaccaccgactgcctgcagctcctggcctacggcaaccag
gagagcaagctgatcatcctggccaatggtgggccccaggccctcgtgcagatcatgcgt
aactacagttatgaaaagctgctctggaccaccagtcgtgtgctcaaggtgctatccgtg
tgtcccagcaataagcctgccattgtggaggctggtgggatgcaggccctgggcaagcac
ctgaccagcaacagcccccgcctggtgcagaactgcctgtggaccctgcgcaacctctca
gatgtggccaccaagcaggagggcctggagagtgtgctgaagattctggtgaatcagctg
agtgtggatgacgtcaacgtcctcacctgtgccacgggcacactctccaacctgacatgc
aacaacagcaagaacaagacgctggtgacacagaacagcggtgtggaggctctcatccat
gccatcctgcgtgctggtgacaaggacgacatcacggagcctgccgtctgcgctctgcgc
cacctcactagccgccaccctgaggccgagatggcccagaactctgtgcgtctcaactat
ggcatcccagccatcgtgaagctgctcaaccagcccaaccagtggccactggtcaaggca
accatcggcttgatcaggaatctggccctgtgcccagccaaccatgccccgctgcaggag
gcagcggtcatcccccgcctcgtccaactgctggtgaaggcccaccaggatgcccagcgc
cacgtagctgcaggcacacagcagccctacacggatggtgtgaggatggaggagattgtg
gagggctgcaccggagcactgcacatcctcgcccgggaccccatgaaccgcatggagatc
ttccggctcaacaccattcccctgtttgtgcagctcctgtactcgtcggtggagaacatc
cagcgcgtggctgccggggtgctgtgtgagctggcccaggacaaggaggcggccgacgcc
attgatgcagagggggcctcggccccactcatggagttgctgcactcccgcaacgagggc
actgccacctacgctgctgccgtcctgttccgcatctccgaggacaagaacccagactac
cggaagcgcgtgtccgtggagctcaccaactccctcttcaagcatgacccggctgcctgg
gaggctgcccagagcatgattcccatcaatgagccctatggagatgacatggatgccacc
taccgccccatgtactccagcgatgtgccccttgacccgctggagatgcacatggacatg
gatggagactaccccatcgacacctacagcgacggcctcaggcccccgtaccccactgca
gaccacatgctggcctag

DBGET integrated database retrieval system