KEGG   Homo sapiens (human): 3735Help
Entry
3735              CDS       T01001                                 

Gene name
KARS, CMTRIB, DFNB89, KARS1, KARS2, KRS
Definition
(RefSeq) lysyl-tRNA synthetase (EC:6.1.1.6)
  KO
K04567  
lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    3735 (KARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     3735 (KARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   3735 (KARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    3735 (KARS)
 Prokaryotic Type
   Other AARSs
    3735 (KARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q23.1
AA seq 597 aa AA seqDB search
MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTT
DNGVGPEEESVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDH
LTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGD
IIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFV
RQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAP
ELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSG
MVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETR
KILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKE
GLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYG
LPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgcaggcggccgaggtgaaagtggatggcagcgagccgaaactgagcaag
aatgagctgaagagacgcctgaaagctgagaagaaagtagcagagaaggaggccaaacag
aaagagctcagtgagaaacagctaagccaagccactgctgctgccaccaaccacaccact
gataatggtgtgggtcctgaggaagagagcgtggacccaaatcaatactacaaaatccgc
agtcaagcaattcatcagctgaaggtcaatggggaagacccatacccacacaagttccat
gtagacatctcactcactgacttcatccaaaaatatagtcacctgcagcctggggatcac
ctgactgacatcaccttaaaggtggcaggtaggatccatgccaaaagagcttctggggga
aagctcatcttctatgatcttcgaggagagggggtgaagttgcaagtcatggccaattcc
agaaattataaatcagaagaagaatttattcatattaataacaaactgcgtcggggagac
ataattggagttcaggggaatcctggtaaaaccaagaagggtgagctgagcatcattccg
tatgagatcacactgctgtctccctgtttgcatatgttacctcatcttcactttggcctc
aaagacaaggaaacaaggtatcgccagagatacttggacttgatcctgaatgactttgtg
aggcagaaatttatcatccgctctaagatcatcacatatataagaagtttcttagatgag
ctgggattcctagagattgaaactcccatgatgaacatcatcccagggggagccgtggcc
aagcctttcatcacttatcacaacgagctggacatgaacttatatatgagaattgctcca
gaactctatcataagatgcttgtggttggtggcatcgaccgggtttatgaaattggacgc
cagttccggaatgaggggattgatttgacgcacaatcctgagttcaccacctgtgagttc
tacatggcctatgcagactatcacgatctcatggaaatcacggagaagatggtttcaggg
atggtgaagcatattacaggcagttacaaggtcacctaccacccagatggcccagagggc
caagcctacgatgttgacttcaccccacccttccggcgaatcaacatggtagaagagctt
gagaaagccctggggatgaagctgccagaaacgaacctctttgaaactgaagaaactcgc
aaaattcttgatgatatctgtgtggcaaaagctgttgaatgccctccacctcggaccaca
gccaggctccttgacaagcttgttggggagttcctggaagtgacttgcatcaatcctaca
ttcatctgtgatcacccacagataatgagccctttggctaaatggcaccgctctaaagag
ggtctgactgagcgctttgagctgtttgtcatgaagaaagagatatgcaatgcgtatact
gagctgaatgatcccatgcggcagcggcagctttttgaagaacaggccaaggccaaggct
gcaggtgatgatgaggccatgttcatagatgaaaacttctgtactgccctggaatatggg
ctgccccccacagctggctggggcatgggcattgatcgagtcgccatgtttctcacggac
tccaacaacatcaaggaagtacttctgtttcctgccatgaaacccgaagacaagaaggag
aatgtagcaaccactgatacactggaaagcacaacagttggcacttctgtctag

DBGET integrated database retrieval system