KEGG   Homo sapiens (human): 3736Help
Entry
3736              CDS       T01001                                 

Gene name
KCNA1, AEMK, EA1, HBK1, HUK1, KV1.1, MBK1, MK1, RBK1
Definition
potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
Orthology
K04874  
potassium voltage-gated channel Shaker-related subfamily A member 1
Organism
hsa  Homo sapiens (human)
Disease
H00749  
Episodic ataxias
Drug target
Other: 
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.32
AA seq 495 aa AA seqDB search
MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPN
TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY
ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS
IVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLCIIWFSFELVVRF
FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF
RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP
DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE
GEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTT
ANQNCVNKSKLLTDV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgatgtctggggagaacgtggacgaggcttcggccgccccgggccacccccag
gatggcagctacccccggcaggccgaccacgacgaccacgagtgctgcgagcgcgtggtg
atcaacatctccgggctgcgcttcgagacgcagctcaagaccctggcgcagttccccaac
acgctgctgggcaaccctaagaaacgcatgcgctacttcgaccccctgaggaacgagtac
ttcttcgaccgcaaccggcccagcttcgacgccatcctctactactaccagtccggcggc
cgcctgcggaggccggtcaacgtgcccctggacatgttctccgaggagatcaagttttac
gagttgggcgaggaggccatggagaagttccgggaggacgagggcttcatcaaggaggag
gagcgccctctgcccgagaaggagtaccagcgccaggtgtggctgctcttcgagtacccc
gagagctcggggcccgccagggtcatcgccatcgtctccgtcatggtcatcctcatctcc
atcgtcatcttttgcctggagacgctccccgagctgaaggatgacaaggacttcacgggc
accgtccaccgcatcgacaacaccacggtcatctacaattccaacatcttcacagacccc
ttcttcatcgtggaaacgctgtgtatcatctggttctccttcgagctggtggtgcgcttc
ttcgcctgccccagcaagacggacttcttcaaaaacatcatgaacttcatagacattgtg
gccatcattccttatttcatcacgctgggcaccgagatagctgagcaggaaggaaaccag
aagggcgagcaggccacctccctggccatcctcagggtcatccgcttggtaagggttttt
agaatcttcaagctctcccgccactctaagggcctccagatcctgggccagaccctcaaa
gctagtatgagagagctagggctgctcatctttttcctcttcatcggggtcatcctgttt
tctagtgcagtgtactttgccgaggcggaagaagctgagtcgcacttctccagtatcccc
gatgctttctggtgggcggtggtgtccatgaccactgtaggatacggtgacatgtaccct
gtgacaattggaggcaagatcgtgggctccttgtgtgccatcgctggtgtgctaacaatt
gccctgcccgtacctgtcattgtgtccaatttcaactatttctaccaccgagaaactgag
ggggaagagcaggctcagttgctccacgtcagttcccctaacttagcctctgacagtgac
ctcagtcgccgcagttcctctactatgagcaagtctgagtacatggagatcgaagaggat
atgaataatagcatagcccattatagacaggtcaatatcagaactgccaattgcaccact
gctaaccaaaactgcgttaataagagcaagctactgaccgatgtttaa

DBGET integrated database retrieval system