KEGG   Homo sapiens (human): 3737Help
Entry
3737              CDS       T01001                                 

Gene name
KCNA2, EIEE32, HBK5, HK4, HUKIV, KV1.2, MK2, NGK1, RBK2
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 2
  KO
K04875  
potassium voltage-gated channel Shaker-related subfamily A member 2
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNA, Kv1.x (Shaker)
   3737 (KCNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p13
AA seq 499 aa AA seqDB search
MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR
VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPS
IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA
NCTLANTNYVNITKMLTDV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggccaccggagacccagcagacgaggctgctgccctccctgggcacccacag
gacacctatgacccagaggcagaccacgagtgctgtgagagggtggtgatcaacatctca
gggctgcggtttgagacccagctaaagaccttagcccagtttccagagaccctcttaggg
gacccaaagaaacgaatgaggtactttgaccccctccgaaatgagtactttttcgatcgg
aaccgccctagctttgatgccattttgtactactaccagtcagggggccgattgaggcga
cctgtgaatgtgcccttagatatattctctgaagaaattcggttttatgagctgggagaa
gaagcgatggagatgtttcgggaagatgaaggctacatcaaggaggaagagcgtcctctg
cctgaaaatgagtttcagagacaagtgtggcttctctttgaatacccagagagctcaggg
cctgccaggattatagctattgtgtctgtcatggtgattctgatctcaattgtcagcttc
tgtctggaaacattgcccatcttccgggatgagaatgaagacatgcatggtagtggggtg
accttccacacctattccaacagcaccatcgggtaccagcagtccacttccttcacagac
cctttcttcattgtagagacactctgcatcatctggttctcctttgaattcttggtgagg
ttctttgcctgtcccagcaaagccggcttcttcaccaacatcatgaacatcattgacatt
gtggccatcatcccctacttcatcaccctggggacagagttggctgagaagccagaggac
gctcagcaaggccagcaggccatgtcactggccatcctccgtgtcatccggttggtaaga
gtctttaggattttcaagttgtccagacactccaaaggtctccagattctaggtcagacc
ctcaaagccagcatgagagaattgggcctcctgatattctttctcttcataggggtcatc
cttttctctagtgctgtgtattttgcagaggccgatgagcgagagtcccagttccccagc
atcccagatgccttctggtgggcagtcgtctccatgacaactgtaggctatggagacatg
gttccgactaccattgggggaaagatagtgggttccctatgtgcgattgcaggtgtgtta
actattgccttaccggtccctgtcattgtgtccaatttcaactacttctaccaccgggag
acagagggagaggaacaggcccaatacttgcaagtgacaagctgtccaaagatcccatcc
tcccctgacctaaagaaaagtagaagtgcctctaccattagtaagtctgattacatggag
atccaggagggtgtaaataacagtaatgaggactttagagaggaaaacttgaaaacagcc
aactgtaccttggctaacacaaactatgtgaatattaccaaaatgttaactgatgtctga

DBGET integrated database retrieval system