KEGG   Homo sapiens (human): 3738Help
Entry
3738              CDS       T01001                                 

Gene name
KCNA3, HGK5, HLK3, HPCN3, HUKIII, KV1.3, MK3, PCN3
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 3
  KO
K04876  
potassium voltage-gated channel Shaker-related subfamily A member 3
Organism
hsa  Homo sapiens (human)
Drug target
Verapamil [DG:DG00329]: 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNA, Kv1.x (Shaker)
   3738 (KCNA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3
AA seq 575 aa AA seqDB search
MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDH
LLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK
TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF
SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET
LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL
AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV
SNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS
AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcgcctcagccttctgcgctcgccgccgccgccctcagcccgccaccgcgcc
caccctcctcagcgcccagcgagcagcggcggtgcccacacgctggtgaaccacggctac
gcggagcccgccgcaggccgcgagctgccgcccgacatgaccgtggtgcccggggaccac
ctgctggagccggaggtggccgatggtggaggggccccgcctcaaggcggctgtggcggc
ggcggctgcgaccgctacgagccgctgccgccctcactgccggccgcgggcgagcaggac
tgctgcggggagcgcgtggtcatcaacatctccgggctgcgcttcgagacgcagctgaag
accctttgccagttccccgagacgctgctgggcgaccccaagcggcgcatgaggtacttc
gacccgctccgcaacgagtacttcttcgaccgcaaccggcccagcttcgacgccatcctc
tactactatcagtccgggggccgcatccgccggccggtcaacgtgcccatcgacattttc
tccgaggagatccgcttctaccagctgggcgaggaggccatggagaagttccgcgaggac
gagggcttcctgcgggaggaggagcggcccttgccccgccgcgacttccagcgccaggtg
tggctgctcttcgagtaccccgagagctccgggccggcccggggcatcgccatcgtgtcc
gtgctggtcatcctcatctccattgtcatcttctgcctggagacgctgccggagttccgc
gacgagaaggactaccccgcctcgacgtcgcaggactcattcgaagcagccggcaacagc
acgtcggggtcccgcgcaggagcctccagcttctccgatcccttcttcgtggtggagacg
ctgtgcatcatctggttctccttcgaactgctggtgcggttcttcgcttgtcctagcaaa
gccaccttctcgcgaaacatcatgaacctgatcgacattgtggccatcattccttatttt
atcactctgggtaccgagctggccgaacgacagggcaatggacagcaggccatgtctctg
gccatcctgagggtcatccgcctggtaagggtcttccgcatcttcaagctgtcgcgccac
tccaaggggctgcagatcctcgggcaaacgctgaaggcgtccatgcgggagctgggattg
ctcatcttcttcctctttattggggtcatccttttctccagcgcggtctactttgccgag
gcagacgaccccacttcaggtttcagcagcatcccggatgccttctggtgggcagtggta
accatgacaacagtgggttacggcgatatgcacccagtgaccatagggggcaagattgtg
ggatctctctgtgccatcgccggtgtcttgaccatcgcattgccagttcccgtgattgtt
tccaacttcaattacttctaccaccgggagacagaaggggaagagcaatcccagtacatg
cacgtgggaagttgccagcacctctcctcttcagccgaggagctccgaaaagcaaggagt
aactcgactctgagtaagtcggagtatatggtgatcgaagaggggggtatgaaccatagc
gctttcccccagacccctttcaaaacgggcaattccactgccacctgcaccacgaacaat
aatcccaactcttgtgtcaacatcaaaaagatattcaccgatgtttaa

DBGET integrated database retrieval system