KEGG   Homo sapiens (human): 373856Help
Entry
373856            CDS       T01001                                 

Gene name
USP41
Definition
ubiquitin specific peptidase 41
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Position
22q11.21
AA seq 337 aa AA seqDB search
MNVDFARILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVWPLELAYCLQKYNVPL
FVQHDAAQLYLKLWNLIKDQIADVHLVERLQALYMIRVKDSLICLDCAMESSRNSSMLTL
RLSFFDVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTI
HLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMA
DSGHYCVYIRSAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWPPFLCHACILIEDGEY
LRLFRPANIRQFTSREETRVECWCVLTLQRKQLQQVW
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggacttcgccaggatattgaagaggatcacggtgcccaggggagctgacgag
cagaggagaagcgtccctttccagatgcttctgctgctggagaagatgcaggacagccgg
cagaaagcagtgtggcccctggagctggcctactgcctgcagaagtacaacgtgcccctg
tttgtccaacatgatgctgcccaactgtacctcaaactctggaacctgattaaggaccag
atcgctgatgtgcacttggtggagagactgcaggccctgtatatgatccgggtgaaggac
tccttgatttgccttgactgtgccatggagagtagcagaaacagcagcatgctcaccctc
cgactttctttttttgatgtggactcaaagcccctgaagacactggaggacgccctgcac
tgcttcttccagcccagggagttatcaagcaaaagcaaatgcttctgtgagaactgtggg
aagaagacccgtgggaaacaggtcttgaagctgacccatttgccccagaccctgacaatc
cacctcatgcgattctccatcaggaattcacagacgagaaagatctgccactccctgtac
ttcccccagagcttggatttcagccagatccttccaatgaagcgagagtcttgtgatgct
gaggagcagtctggagggcagtatgagctttttgctgtgattgcgcacgtgggaatggca
gactccggtcattactgtgtctacatccggagtgctgtggatggaaaatggttctgcttc
aatgactccaatatttgcttggtgtcctgggaagacatccagtgtacctacggaaatcct
aactaccactggcctccttttctttgtcatgcatgcatattaattgaggatggagaatat
ctacgcttgttcaggccagccaacatacgacagtttacttcaagagaggagacacgggtt
gaatgctggtgtgttttaactctgcagcgcaaacagttgcaacaagtgtggtga

DBGET integrated database retrieval system