KEGG   Homo sapiens (human): 373856Help
Entry
373856            CDS       T01001                                 

Gene name
USP41
Definition
ubiquitin specific peptidase 41
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     373856 (USP41)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   373856 (USP41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Position
22q11.21
AA seq 344 aa AA seqDB search
MDGVLFRAHQCQYVHPCVHVYVTVGLMDPLSFFSLPLIGLVGLHNIGQTCCLNSLIQVFV
MNVDFARILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVWPLELAYCLQKYNVPL
FVQHDAAQLYLKLWNLIKDQIADVHLVERLQALYMIRVKDSLICLDCAMESSRNSSMLTL
RLSFFDVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTI
HLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMA
DSGHYCVYIRSAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHW
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgtcttgttcagggctcatcagtgtcagtacgtgcatccttgtgtacatgtg
tatgtcactgtgggcctcatggatcccctgtcatttttttctcttccccttataggcctg
gttggtttacacaacattggacagacctgctgccttaactccttgattcaggtgtttgta
atgaatgtggacttcgccaggatattgaagaggatcacggtgcccaggggagctgacgag
cagaggagaagcgtccctttccagatgcttctgctgctggagaagatgcaggacagccgg
cagaaagcagtgtggcccctggagctggcctactgcctgcagaagtacaacgtgcccctg
tttgtccaacatgatgctgcccaactgtacctcaaactctggaacctgattaaggaccag
atcgctgatgtgcacttggtggagagactgcaggccctgtatatgatccgggtgaaggac
tccttgatttgccttgactgtgccatggagagtagcagaaacagcagcatgctcaccctc
cgactttctttttttgatgtggactcaaagcccctgaagacactggaggacgccctgcac
tgcttcttccagcccagggagttatcaagcaaaagcaaatgcttctgtgagaactgtggg
aagaagacccgtgggaaacaggtcttgaagctgacccatttgccccagaccctgacaatc
cacctcatgcgattctccatcaggaattcacagacgagaaagatctgccactccctgtac
ttcccccagagcttggatttcagccagatccttccaatgaagcgagagtcttgtgatgct
gaggagcagtctggagggcagtatgagctttttgctgtgattgcgcacgtgggaatggca
gactccggtcattactgtgtctacatccggagtgctgtggatggaaaatggttctgcttc
aatgactccaatatttgcttggtgtcctgggaagacatccagtgtacctacggaaatcct
aactaccactggtaa

DBGET integrated database retrieval system