KEGG   Homo sapiens (human): 3739Help
Entry
3739              CDS       T01001                                 

Gene name
KCNA4, HBK4, HK1, HPCN2, HUKII, KCNA4L, KCNA8, KV1.4, PCN2
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 4
  KO
K04877  
potassium voltage-gated channel Shaker-related subfamily A member 4
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNA, Kv1.x (Shaker)
   3739 (KCNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p14
AA seq 653 aa AA seqDB search
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGG
SHHHHQSRGACTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRE
LSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVI
NVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGR
LKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYP
ESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGLLNDTSAPHLE
NSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLG
TDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGL
LIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIV
GSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSS
TSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgcaatggtgagtgcggagagctcagggtgcaacagtcacatgccttatggt
tatgctgcccaggcccgggcccgggagcgggagaggcttgctcactccagggcagctgca
gcagctgctgttgcagcggccacagctgctgtcgaaggtagcgggggttctggtgggggc
tcccaccaccaccaccagtcacgcggggcctgtacctcccatgaccctcagagcagccgg
ggtagtcggaggaggaggcgacagcggtctgagaagaagaaagcccactaccggcagagc
agcttccctcattgctctgacctgatgcccagtggctctgaggagaagatcctgagggag
ctgagtgaggaggaggaagatgaggaggaggaggaagaggaggaagaggagggaaggttt
tactatagtgaagatgaccatggtgatgagtgttcctacacggatctgctgcctcaggat
gagggcggtggcggctacagttcagtccgctacagtgactgttgtgaacgtgtggtgata
aatgtgtcaggcctacgctttgagacccaaatgaaaactctggcccagtttccagagact
ttgttgggagaccctgaaaagaggactcagtactttgaccctttgcgcaatgagtatttt
tttgacaggaaccgccccagctttgatgccatcttgtattattatcaatcaggaggccgc
ctgaagaggccagtcaatgtcccctttgatatcttcactgaggaggtgaagttctatcag
ttgggggaggaggccctgttgaagtttcgggaggacgagggctttgtgagagaagaggaa
gacagggccctccccgagaatgaatttaaaaagcagatttggctcctctttgaatatcca
gagagctccagtcctgcaaggggcatagccattgtgtccgtcctggtcatcttaatctcc
attgtcatcttttgcctggaaaccttgcctgagtttagggacgacagggatctcgtcatg
gcactgagtgctggcgggcatggtgggttgttgaatgatacttcagcaccccatctggag
aactcagggcacacaatattcaatgaccccttcttcatcgtggaaacagtctgtattgta
tggttttcctttgagtttgtggttcgctgctttgcttgtcccagccaagcactcttcttc
aaaaacatcatgaacatcattgacattgtctccattttgccttacttcatcacactgggc
actgacctggcccagcaacaggggggtggcaatggtcagcagcagcaggccatgtccttt
gccatcctcagaatcattcgtctggtccgagtattccggatcttcaaactctccaggcac
tccaaaggcctgcagatcctgggccacaccctcagagccagcatgcgggaactgggcctt
ctgatcttcttcctcttcattggggtcatcctcttttctagtgctgtgtattttgcagag
gcggatgaacctactacccatttccaaagcatcccagatgcattttggtgggctgtggtg
accatgacaactgtgggctatggggacatgaagcccatcactgtagggggcaagattgtc
gggtccctgtgtgccattgcgggtgtcttaaccattgctttgccagtgccagtgattgtc
tctaactttaactatttctaccacagagagactgaaaatgaggaacagacacagctaacg
cagaatgcagtcagttgtccatacctcccctctaatttgctcaagaaatttcggagctct
acttcttcttccctgggggacaagtcagagtatctagagatggaagaaggagttaaggaa
tctctgtgtgcaaaggaggagaagtgtcagggaaagggggatgacagtgagacagataaa
aacaactgttctaatgcaaaggctgtggagactgatgtgtga

DBGET integrated database retrieval system