KEGG   Homo sapiens (human): 374Help
Entry
374               CDS       T01001                                 

Gene name
AREG, AR, AREGB, CRDGF, SDGF
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05210  Colorectal cancer
Network
N00279  AREG-EGFR-RAS-ERK signaling pathway
N00280  AREG-overexpression to RAS-ERK signaling pathway
N00284  AREG-EGFR-PI3K signaling pathway
N00285  AREG-overexpression to PI3K signaling pathway
Disease
H00020  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    374 (AREG)
   04012 ErbB signaling pathway
    374 (AREG)
   04390 Hippo signaling pathway
    374 (AREG)
   04151 PI3K-Akt signaling pathway
    374 (AREG)
 Human Diseases
  Cancers
   05210 Colorectal cancer
    374 (AREG)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Others
   374 (AREG)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   374 (AREG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FtsL EGF
Motif
Other DBs
NCBI-GeneID: 374
NCBI-ProteinID: NP_001648
OMIM: 104640
HGNC: 651
Ensembl: ENSG00000109321
Vega: OTTHUMG00000130006
Pharos: P15514(Tbio)
UniProt: P15514
Structure
PDB: 

Jmol
Position
4q13.3
AA seq 252 aa AA seqDB search
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKK
LRQENGNVHAIA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagagccccgctgctaccgccggcgccggtggtgctgtcgctcttgatactcggctca
ggccattatgctgctggattggacctcaatgacacctactctgggaagcgtgaaccattt
tctggggaccacagtgctgatggatttgaggttacctcaagaagtgagatgtcttcaggg
agtgagatttcccctgtgagtgaaatgccttctagtagtgaaccgtcctcgggagccgac
tatgactactcagaagagtatgataacgaaccacaaatacctggctatattgtcgatgat
tcagtcagagttgaacaggtagttaagcccccccaaaacaagacggaaagtgaaaatact
tcagataaacccaaaagaaagaaaaagggaggcaaaaatggaaaaaatagaagaaacaga
aagaagaaaaatccatgtaatgcagaatttcaaaatttctgcattcacggagaatgcaaa
tatatagagcacctggaagcagtaacatgcaaatgtcagcaagaatatttcggtgaacgg
tgtggggaaaagtccatgaaaactcacagcatgattgacagtagtttatcaaaaattgca
ttagcagccatagctgcctttatgtctgctgtgatcctcacagctgttgctgttattaca
gtccagcttagaagacaatacgtcaggaaatatgaaggagaagctgaggaacgaaagaaa
cttcgacaagagaatggaaatgtacatgctatagcataa

DBGET integrated database retrieval system