KEGG   Homo sapiens (human): 374Help
Entry
374               CDS       T01001                                 

Gene name
AREG, AR, CRDGF, SDGF
Definition
amphiregulin
Orthology
K09782  
amphiregulin
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Hippo signaling pathway
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q13.3
AA seq 252 aa AA seqDB search
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKK
LRQENGNVHAIA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagagccccgctgctaccgccggcgccggtggtgctgtcgctcttgatactcggctca
ggccattatgctgctggattggacctcaatgacacctactctgggaagcgtgaaccattt
tctggggaccacagtgctgatggatttgaggttacctcaagaagtgagatgtcttcaggg
agtgagatttcccctgtgagtgaaatgccttctagtagtgaaccgtcctcgggagccgac
tatgactactcagaagagtatgataacgaaccacaaatacctggctatattgtcgatgat
tcagtcagagttgaacaggtagttaagcccccccaaaacaagacggaaagtgaaaatact
tcagataaacccaaaagaaagaaaaagggaggcaaaaatggaaaaaatagaagaaacaga
aagaagaaaaatccatgtaatgcagaatttcaaaatttctgcattcacggagaatgcaaa
tatatagagcacctggaagcagtaacatgcaaatgtcagcaagaatatttcggtgaacgg
tgtggggaaaagtccatgaaaactcacagcatgattgacagtagtttatcaaaaattgca
ttagcagccatagctgcctttatgtctgctgtgatcctcacagctgttgctgttattaca
gtccagcttagaagacaatacgtcaggaaatatgaaggagaagctgaggaacgaaagaaa
cttcgacaagagaatggaaatgtacatgctatagcataa

DBGET integrated database retrieval system