KEGG   Homo sapiens (human): 3742Help
Entry
3742              CDS       T01001                                 

Gene name
KCNA6, HBK2, KV1.6, PPP1R96
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 6
  KO
K04879  
potassium voltage-gated channel Shaker-related subfamily A member 6
Organism
hsa  Homo sapiens (human)
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     3742 (KCNA6)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNA, Kv1.x (Shaker)
   3742 (KCNA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13
AA seq 529 aa AA seqDB search
MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLS
LFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFLEE
IRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPQFRVDGRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITP
GEMGTGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIID
LVAIFPYFITLGTELVQQQEQQPASGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSK
GLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTM
TTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHV
TCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggagaaatcccttacgctggcggcgccgggggaggtccgtgggccggaggga
gagcaacaggatgcgggagacttcccggaggccggcgggggcgggggctgctgtagtagc
gagcggctggtgatcaatatctccgggctgcgctttgagacacaattgcgcaccctgtcg
ctgtttccggacacgctgctcggagaccctggccggcgagtccgcttcttcgaccccctg
aggaacgagtacttcttcgaccgcaaccggcccagcttcgacgccatcctctactactac
cagtctgggggccgcctgcggaggccggtcaacgtgcccctggacattttcctggaggag
atccgcttctaccagctgggggacgaggccctggcggccttccgggaggacgagggctgc
ctgcccgaaggtggcgaggacgagaagccgctgccctcccagcccttccagcgccaggtg
tggctgctctttgagtacccagagagctctgggccggccaggggcatcgccatcgtctcc
gtgttggtcattctcatctccatagtcatcttttgcctggagaccttaccccagttccgt
gtagatggtcgaggtggaaacaatggtggtgtgagtcgagtctccccagtttccaggggg
agtcaggaggaagaggaggatgaagacgattcctacacatttcatcatggcatcacccct
ggggaaatggggaccgggggctcctcctcactcagtactcttgggggctccttctttaca
gaccccttctttctggtggagacgctgtgcattgtctggttcacttttgagctcctggtg
cgcttctccgcctgccctagcaagccggccttcttccggaacatcatgaacatcattgac
ttggtggctatcttcccctacttcatcaccctgggcactgagctggtgcagcagcaggag
cagcaaccagccagtggaggaggcggccagaatgggcagcaggccatgtccctggccatc
ctccgagtcatccgcctggtccgggtgttccgcatcttcaagctctcccgccactccaag
gggctgcagatcctgggcaagaccttgcaggcctccatgagggagctggggctgctcatc
ttcttcctcttcatcggggtcatcctcttctccagtgccgtctacttcgcagaggctgac
gatgacgattcgctttttcccagcatcccggatgccttctggtgggcagtggttacaatg
accacggtaggttacggggacatgtaccccatgactgtggggggaaagatcgtgggctcg
ctgtgtgccatcgctggggtcctcaccattgccctgcctgtgcccgtcatcgtctccaac
ttcaactacttctaccaccgggagacggagcaggaggagcaaggccagtatacccacgtc
acttgtgggcagcctgcgccggacctgagggcaactgacaacggacttggcaagcctgac
ttccccgaggctaaccgggaacggagacccagctaccttcctacaccacatcgggcctat
gcagagaaaagaatgctcacggaggtctga

DBGET integrated database retrieval system