KEGG   Homo sapiens (human): 3746Help
Entry
3746              CDS       T01001                                 

Gene name
KCNC1, EPM7, KV3.1, KV4, NGK2
Definition
(RefSeq) potassium voltage-gated channel subfamily C member 1
  KO
K04887  
potassium voltage-gated channel Shaw-related subfamily C member 1
Organism
hsa  Homo sapiens (human)
Drug target
Other: 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNC, Kv3.x (Shaw)
   3746 (KCNC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15
AA seq 511 aa AA seqDB search
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH
PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD
SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF
EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE
TEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS
KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA
TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC
ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH
HSTQSDTCPLAQEEILEINRAGRKPLRGMSI
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaggggacgagagcgagcgcatcgtgatcaacgtgggcggcacgcgccaccag
acgtaccgctcgaccctgcgcacgctgcccggcacgcggctcgcctggctggcggagccc
gacgcccacagccacttcgactatgacccgcgtgctgacgagttcttcttcgaccgccac
cccggcgtcttcgcgcacatcctgaactactaccgcacgggcaagctgcactgcccagcc
gacgtgtgcgggccgctctacgaggaggagctggccttctggggcatcgacgagaccgac
gtggagccctgctgctggatgacgtaccgccagcaccgcgacgccgaggaggctctggac
agcttcggcggcgctcctctggacaacagcgccgacgacgcggacgccgacggccctggc
gactcgggcgacggcgaggacgagctggagatgaccaagcgcctggcgctcagtgactcc
ccggatggccggcctggcggcttttggcgccgctggcagccgcgcatctgggcgctcttc
gaggacccgtactcgtcccgctacgcgcggtatgtggccttcgcttccctcttcttcatc
ctggtctccatcaccaccttctgcctggagacccacgagcgcttcaaccccatcgtgaac
aagacggagatcgagaacgttcgcaatggcacgcaagtgcgctactaccgggaggccgag
acggaggccttccttacctacatcgagggcgtctgtgtggtctggttcaccttcgagttc
ctcatgcgtgtcatcttctgccccaacaaggtagagttcatcaagaactcgctcaacatc
attgactttgtggccatcctgcccttctacctggaggtggggctgagcggcctgtcctcc
aaggcagccaaggacgtgctgggcttcctgcgcgtcgtccgcttcgtgcgcatcttgcgc
atctttaagctgacccgccactttgtgggcctgcgggtcctgggccacacgctccgagcc
agcaccaacgagttcctgctgctcatcatcttcctggccttgggcgtgctgatcttcgcc
accatgatctactacgccgagaggataggggcacagcccaatgaccccagcgccagtgag
cacacgcactttaagaacatccccatcggcttctggtgggccgtggtcaccatgacgacc
ctgggctatggagacatgtacccgcagacgtggtccggcatgctggtgggggctctgtgt
gcgctggcgggcgtgctcaccatcgccatgcccgtgcccgtcatcgtgaacaatttcggg
atgtattactccttagccatggctaagcagaaactaccaaagaaaaaaaagaagcatatt
ccgcggccaccgcagctgggatctcccaattattgtaaatctgtcgtaaactctccacac
cacagtactcagagtgacacatgtccgctggcccaggaagaaattttagaaattaacaga
gcaggtaggaaacctcttagaggcatgtcgatctga

DBGET integrated database retrieval system