KEGG   Homo sapiens (human): 3747Help
Entry
3747              CDS       T01001                                 

Gene name
KCNC2, KV3.2
Definition
(RefSeq) potassium voltage-gated channel subfamily C member 2
  KO
K04888  
potassium voltage-gated channel Shaw-related subfamily C member 2
Organism
hsa  Homo sapiens (human)
Drug target
Verapamil (DG00329): 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNC, Kv3.x (Shaw)
   3747 (KCNC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q14.1
AA seq 638 aa AA seqDB search
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPP
LSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRT
GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG
DDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFIL
VSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVR
IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK
LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY
SLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVL
SGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRS
LNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcgagaacaacgagagggtgatcctcaatgtcgggggcacccggcacgaa
acctaccgcagcaccctcaagaccctgcctggaacacgcctggcccttcttgcctcctcc
gagcccccaggcgactgcttgaccacggcgggcgacaagctgcagccgtcgccgcctcca
ctgtcgccgccgccgagagcgcccccgctgtcccccgggccaggcggctgcttcgagggc
ggcgcgggcaactgcagttcccgcggcggcagggccagcgaccatcccggtggcggccgc
gagttcttcttcgaccggcacccgggcgtcttcgcctatgtgctcaattactaccgcacc
ggcaagctgcactgccccgcagacgtgtgcgggccgctcttcgaggaggagctggccttc
tggggcatcgacgagaccgacgtggagccctgctgctggatgacctaccggcagcaccgc
gacgccgaggaggcgctggacatcttcgagacccccgacctcattggcggcgaccccggc
gacgacgaggacctggcggccaagaggctgggcatcgaggacgcggcggggctcgggggc
cccgacggcaaatctggccgctggaggaggctgcagccccgcatgtgggccctcttcgaa
gacccctactcgtccagagccgccaggtttattgcttttgcttctttattcttcatcctg
gtttcaattacaactttttgcctggaaacacatgaagctttcaatattgttaaaaacaag
acagaaccagtcatcaatggcacaagtgttgttctacagtatgaaattgaaacggatcct
gccttgacgtatgtagaaggagtgtgtgtggtgtggtttacttttgaatttttagtccgt
attgttttttcacccaataaacttgaattcatcaaaaatctcttgaatatcattgacttt
gtggccatcctacctttctacttagaggtgggactcagtgggctgtcatccaaagctgct
aaagatgtgcttggcttcctcagggtggtaaggtttgtgaggatcctgagaattttcaag
ctcacccgccattttgtaggtctgagggtgcttggacatactcttcgagctagtactaat
gaatttttgctgctgataattttcctggctctaggagttttgatatttgctaccatgatc
tactatgccgagagagtgggagctcaacctaacgacccttcagctagtgagcacacacag
ttcaaaaacattcccattgggttctggtgggctgtagtgaccatgactaccctgggttat
ggggatatgtacccccaaacatggtcaggcatgctggtgggagccctgtgtgctctggct
ggagtgctgacaatagccatgccagtgcctgtcattgtcaataattttggaatgtactac
tccttggcaatggcaaagcagaaacttccaaggaaaagaaagaagcacatccctcctgct
cctcaggcaagctcacctactttttgcaagacagaattaaatatggcctgcaatagtaca
cagagtgacacatgtctgggcaaagacaatcgacttctggaacataacagatcagtgtta
tcaggtgacgacagtacaggaagtgagccgccactatcacccccagaaaggctccccatc
agacgctctagtaccagagacaaaaacagaagaggggaaacatgtttcctactgacgaca
ggtgattacacgtgtgcttctgatggagggatcaggaaaggatatgaaaaatcccgaagc
ttaaacaacatagcgggcttggcaggcaatgctctgaggctctctccagtaacatcaccc
tacaactctccttgtcctctgaggcgctctcgatctcccatcccatctatcttgtaa

DBGET integrated database retrieval system