KEGG   Homo sapiens (human): 3748Help
Entry
3748              CDS       T01001                                 

Gene name
KCNC3, KSHIIID, KV3.3, SCA13
Definition
(RefSeq) potassium voltage-gated channel subfamily C member 3
  KO
K04889  
potassium voltage-gated channel Shaw-related subfamily C member 3
Organism
hsa  Homo sapiens (human)
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNC, Kv3.x (Shaw)
   3748 (KCNC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 757 aa AA seqDB search
MLSSVCVSSFRGRQGASKQQPAPPPQPPESPPPPPLPPQQQQPAQPGPAASPAGPPAPRG
PGDRRAEPCPGLPAAAMGRHGGGGGDSGKIVINVGGVRHETYRSTLRTLPGTRLAGLTEP
EAAARFDYDPGADEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETD
VEACCWMTYRQHRDAEEALDSFEAPDPAGAANAANAAGAHDGGLDDEAGAGGGGLDGAGG
ELKRLCFQDAGGGAGGPPGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFFI
LISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVWFT
FEFLMRITFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVR
ILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDIL
GSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVN
NFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGISPPPPI
TPPSMGVTVAGAYPAGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIEINRAD
PRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGS
IRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctcagtctgcgtctcgtccttccgcgggcgccagggggccagcaagcagcag
ccggcgccaccgccgcagccgcccgagtccccgccgccgccaccgctgccgccgcagcag
cagcagcctgcgcagcccggccccgccgcgtccccggcgggccccccggcaccccgcggg
cccggggaccggcgcgccgagccatgccccgggctgccggcggcggccatggggcggcac
ggcggcggcggtggcgacagcggcaagatcgtgatcaacgtgggcggcgtgcgccatgag
acgtaccgctcgacgctgcgcaccctgccggggacgcggctggccggcctgacggagccc
gaggcggcggcacgcttcgactacgacccgggcgccgacgagttcttctttgaccggcac
ccgggagtcttcgcgtacgtgctcaactactaccgcaccggcaagctgcactgcccagcc
gacgtgtgcgggcccctgtttgaggaggagctcggcttctggggcatcgacgagaccgac
gtggaggcctgctgctggatgacctaccggcagcatcgcgacgctgaggaggcgctcgac
tccttcgaggcgcccgaccccgcgggcgccgccaacgccgccaacgccgcaggcgcccac
gacggaggcctggacgacgaggcgggcgcgggcggcggcggcctggacggagcgggcggc
gagctcaagcgcctctgcttccaggacgcgggcggcggcgccggggggccgccagggggc
gcgggcggcgcgggcggcacatggtggcgccgctggcagccccgcgtgtgggcgctcttc
gaggacccctactcgtcgcgggctgccaggtatgtggccttcgcctccctcttcttcatc
ctcatctccatcaccaccttctgcctggaaacccatgagggcttcatccatattagcaac
aagacggtgacccaggcctccccgatccccggggcacctccggagaacatcaccaacgtg
gaggtggagacggagcccttcctgacctacgtggagggggtgtgcgtggtctggttcacc
ttcgagttcctcatgcgcatcaccttctgcccagacaaggtggagtttcttaaaagcagc
ctcaacatcatcgactgtgtggccatcctgcccttctatctcgaggtgggcctctcgggc
ctcagctccaaggccgccaaagacgtgctgggcttcctgcgggtggtccgcttcgtccgc
atcctgcgcatcttcaagctgacccggcacttcgtggggctgcgcgtgctgggacacacg
ctccgcgccagcaccaacgagttcctgctgctcatcatcttcctggccctgggggtgctc
atcttcgccaccatgatttactacgctgagcgcattggcgccgaccccgatgacatcctg
ggctccaaccacacctacttcaagaacatccccattggcttctggtgggctgtggtcacc
atgacgaccctgggctatggagacatgtaccccaagacgtggtcggggatgctggtcggg
gcgctgtgtgccctggcgggggtgctgaccatcgccatgcctgtgcccgtcattgtcaac
aactttggcatgtactattcgctggccatggccaagcagaagctgcccaagaagaagaac
aaacacatcccccggcccccgcaaccgggctcgcccaactactgcaagcctgacccaccc
ccgccacccccgccccacccgcaccacggcagcgggggcatcagcccgccgccacccatc
accccaccctccatgggggtgactgtggccggggcctacccagcggggccccacacgcac
cccgggctgctcagggggggagcgggtgggctggggatcatggggctgcctcctctgcca
gcccccggcgagccttgcccgttggctcaggaggaggtgattgagatcaaccgggcagat
cctcgccccaatggggatccggcagcagctgcgcttgcccacgaggactgcccagccatt
gaccagcctgccatgtccccggaagacaagagccccatcacgcctggaagccgtggccgc
tatagccgggaccgagcctgcttcctcctcaccgactatgccccttcccctgatggctcc
atccgaaaagccactggtgctcccccactgcccccccaagactggcgtaagccaggcccc
ccaagcttcttgcccgacctcaacgccaacgccgcggcctggatatccccctag

DBGET integrated database retrieval system