KEGG   Homo sapiens (human): 374875Help
Entry
374875            CDS       T01001                                 

Gene name
HSD11B1L, 11-DH3, 11-beta-HSD3, HSD3, SCDR10, SCDR10B, SDR26C2
Definition
(RefSeq) hydroxysteroid (11-beta) dehydrogenase 1-like (EC:1.1.1.-)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 315 aa AA seqDB search
MKVLLLTGLGALFFAYYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTA
HTEALLQKVVGNCRKLGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAP
AGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSA
AKFALDGFFGSLRRELDVQDVNVAITMCVLGLRDRASAAEAVRSSTSRPRQPEHRGVPLQ
SQTAMFLPPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVPRVR
RLCRGLARPHLFGHD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgcttctcctcacagggctgggggccctgttcttcgcctattattgggatgac
aacttcgacccagccagcctccagggagcgcgagtgctgctgacaggggccaacgctggt
gttggtgaggagctggcctatcactacgcgcgtctgggctcccacctggtgctcactgcc
cacactgaggctctcctgcagaaggtggtagggaactgccggaagctgggcgcccccaag
gtcttctacatcgcggcggacatggcctcccctgaggcgcccgagagcgtggtgcagttt
gcgctggacaagctgggcgggctggactacctcgtgctgaaccacatcggcggcgccccg
gccggcacgcgagcccgcagcccccaggcaactcgctggctcatgcaggtaaactttgtg
agctacgtgcaactgacgtcgcgggcgctgcccagcctgacggacagcaagggctccctg
gtggtggtgtcctcgctgctcggccgcgtgcccacgtcgttctccactccctactcggcg
gccaagtttgcgctggacggcttcttcggctccctgcggcgggagctggacgtgcaggac
gtgaacgtggccatcaccatgtgcgtcctgggcctccgagatcgcgcctccgccgccgag
gcagtcaggagctcaacgtcacggccgcggcagcctgagcaccggggggtgcccctccag
tcccagacggcaatgttcctccctccaactgtccctggagccagaacactcacagagaca
cccctgagagggtggccacagcccaagatgaagtcatcaagacagaaaagcaaaaccgag
aaaaacgacgggcacctggaaccagtcacggcttgggaggtgcaggtgccccgtgttagg
cgcctttgtcggggacttgcaaggcctcacctgtttggccatgattga

DBGET integrated database retrieval system