KEGG   Homo sapiens (human): 374900Help
Entry
374900            CDS       T01001                                 

Gene name
ZNF568, ZFP568
Definition
(RefSeq) zinc finger protein 568
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    374900 (ZNF568)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_jaz zinc_ribbon_15 zf-C2H2_11 zf-C2HE zf-AN1 ADK_lid C1_4 Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 374900
NCBI-ProteinID: NP_940941
OMIM: 617566
HGNC: 25392
Ensembl: ENSG00000198453
Vega: OTTHUMG00000048160
Pharos: Q3ZCX4(Tdark)
UniProt: Q3ZCX4 Q96AZ9
Position
19q13.12
AA seq 644 aa AA seqDB search
MTSQSSVISNSCVTMERLSHMMERKAWCSQESALSEEEEDTTRPLETVTFKDVAVDLTQE
EWEQMKPAQRNLYRDVMLENYSNLVTVGCQVTKPDVIFKLEQEEEPWVMEEEMFGRHCPE
VWEVDEQIKKQQETLVRKVTSISKKILIKEKVIECKKVAKIFPLSSDIVTSRQSFYDCDS
LDKGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRH
ERIHAGEKPYECKECGKAFSRKENLITHQKIHTGEKPYKCNECGKAFIQMSNLIRHHRIH
TGEKPYACKDCWKAFSQKSNLIEHERIHTGEKPYECKECGKSFSQKQNLIEHEKIHTGEK
PYACNECGRAFSRMSSVTLHMRSHTGEKPYKCNKCGKAFSQCSVFIIHMRSHTGEKPYVC
SECGKAFSQSSSLTVHMRNHTAEKPYECKECGKAFSRKENLITHQKIHTGEKPYECSECG
KAFIQMSNLIRHQRIHTGEKPYACTVCGKAFSQKSNLTEHEKIHTGEKPYHCNQCGKAFS
QRQNLLEHEKIHTGEKPFKCNECGKAFSRISSLTLHVRSHTGEKPYECNKCGKAFSQCSL
LIIHMRSHTGEKPFECNECGKAFSQRASLSIHKRGHTGERHQVY
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcaatcttcagtgatcagcaatagctgtgtgacaatggagcgtttgagccac
atgatggaaaggaaagcttggtgttctcaagagtctgccctttccgaggaagaagaggat
acaaccaggcctcttgaaacagtgacatttaaggatgtggctgttgaccttacccaggag
gagtgggagcaaatgaaacctgctcaaagaaacttgtatcgagatgtgatgctggagaac
tacagcaacctagtcacagtgggctgtcaagtcaccaaaccggatgtgatattcaagttg
gagcaagaagaggagccctgggtgatggaggaagaaatgtttgggaggcactgtccagaa
gtttgggaagttgatgaacagatcaagaagcaacaggaaacacttgtgaggaaagtcaca
tccatctccaagaaaattctgataaaggaaaaagtcattgaatgtaaaaaagttgcgaaa
atatttcctctgagttcagacattgttacttcaagacaaagcttctatgactgtgactca
cttgataagggtttggaacataatttagacttacttagatatgagaaaggctgtgtaaga
gagaaacagagtaatgagtttgggaaaccattttaccattgtgcatcctatgttgtaacc
ccctttaagtgtaatcagtgtggacaagacttcagtcataaatttgacctcattagacat
gagcgaattcatgctggagagaaaccttacgaatgtaaagaatgtggaaaagccttcagt
aggaaggaaaatcttattacacatcagaaaattcatactggggaaaaaccgtataagtgt
aatgaatgtggaaaagctttcattcagatgtcaaaccttattagacaccacagaattcat
actggggagaaaccttatgcatgtaaggattgttggaaagccttcagtcagaaatcaaat
ctcattgaacatgagcgaattcacactggagagaaaccctatgaatgtaaggaatgtggg
aaatccttcagccagaagcaaaatcttattgagcacgagaaaattcatactggggagaaa
ccttatgcatgtaatgaatgtggtagagctttttctcgaatgtcatctgttacgctacat
atgagaagtcacacaggggagaaaccctataaatgtaataaatgtggaaaagctttctct
caatgctcagtatttattatacatatgagaagtcacactggtgagaaaccctatgtatgt
agtgaatgtgggaaagccttctctcagagttcatccctaaccgtacatatgcgaaatcat
acagctgagaaaccctatgaatgtaaggaatgtggaaaagccttcagcaggaaagaaaat
ctcattacacatcagaaaattcacactggagagaaaccttatgaatgcagtgaatgtggg
aaagcttttattcagatgtcaaacctcattcgacaccagagaattcatacgggtgagaaa
ccctatgcatgtacagtatgtggaaaagcctttagtcagaaatcaaacctcactgaacat
gagaaaattcatactggagagaaaccttatcattgtaatcaatgtgggaaagctttcagt
cagagacaaaatcttcttgagcatgaaaaaattcatactggagagaaaccattcaaatgt
aatgaatgtggtaaagccttctctcgaatctcatccctcactcttcatgtgagaagtcac
acaggggagaaaccctatgaatgtaataaatgtgggaaagccttttctcagtgctcatta
cttattatacatatgagaagtcatactggtgagaaaccctttgaatgtaatgaatgtggg
aaagcattctctcaaagagcatccctttctatacataagagaggtcatacaggtgagaga
caccaagtatattaa

DBGET integrated database retrieval system