KEGG   Homo sapiens (human): 374900Help
Entry
374900            CDS       T01001                                 

Gene name
ZNF568
Definition
zinc finger protein 568
Orthology
K09228  
KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.12
AA seq 643 aa AA seqDB search
MTSQSSVISNSCVTMERLSHMMERKAWCSQESALSEEEEDTTRPLETVTFKDVAVDLTQE
EWEQMKPAQRNLYRDVMLENYSNLVTVGCQVTKPDVIFKLEQEEEPWVMEEEMFGRHCPV
WEVDEQIKKQQETLVRKVTSISKKILIKEKVIECKKVAKIFPLSSDIVTSRQSFYDCDSL
DKGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRHE
RIHAGEKPYECKECGKAFSRKENLITHQKIHTGEKPYKCNECGKAFIQMSNLIRHHRIHT
GEKPYACKDCWKAFSQKSNLIEHERIHTGEKPYECKECGKSFSQKQNLIEHEKIHTGEKP
YACNECGRAFSRMSSVTLHMRSHTGEKPYKCNKCGKAFSQCSVFIIHMRSHTGEKPYVCS
ECGKAFSQSSSLTVHMRNHTAEKPYECKECGKAFSRKENLITHQKIHTGEKPYECSECGK
AFIQMSNLIRHQRIHTGEKPYACTVCGKAFSQKSNLTEHEKIHTGEKPYHCNQCGKAFSQ
RQNLLEHEKIHTGEKPFKCNECGKAFSRISSLTLHVRSHTGEKPYECNKCGKAFSQCSLL
IIHMRSHTGEKPFECNECGKAFSQRASLSIHKRGHTGERHQVY
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcaatcttcagtgatcagcaatagctgtgtgacaatggagcgtttgagccac
atgatggaaaggaaagcttggtgttctcaagagtctgccctttccgaggaagaagaggat
acaaccaggcctcttgaaacagtgacatttaaggatgtggctgttgaccttacccaggag
gagtgggagcaaatgaaacctgctcaaagaaacttgtatcgagatgtgatgctggagaac
tacagcaacctagtcacagtgggctgtcaagtcaccaaaccggatgtgatattcaagttg
gagcaagaagaggagccctgggtgatggaggaagaaatgtttgggaggcactgtccagtt
tgggaagttgatgaacagatcaagaagcaacaggaaacacttgtgaggaaagtcacatcc
atctccaagaaaattctgataaaggaaaaagtcattgaatgtaaaaaagttgcgaaaata
tttcctctgagttcagacattgttacttcaagacaaagcttctatgactgtgactcactt
gataagggtttggaacataatttagacttacttagatatgagaaaggctgtgtaagagag
aaacagagtaatgagtttgggaaaccattttaccattgtgcatcctatgttgtaaccccc
tttaagtgtaatcagtgtggacaagacttcagtcataaatttgacctcattagacatgag
cgaattcatgctggagagaaaccttacgaatgtaaagaatgtggaaaagccttcagtagg
aaggaaaatcttattacacatcagaaaattcatactggggaaaaaccgtataagtgtaat
gaatgtggaaaagctttcattcagatgtcaaaccttattagacaccacagaattcatact
ggggagaaaccttatgcatgtaaggattgttggaaagccttcagtcagaaatcaaatctc
attgaacatgagcgaattcacactggagagaaaccctatgaatgtaaggaatgtgggaaa
tccttcagccagaagcaaaatcttattgagcacgagaaaattcatactggggagaaacct
tatgcatgtaatgaatgtggtagagctttttctcgaatgtcatctgttacgctacatatg
agaagtcacacaggggagaaaccctataaatgtaataaatgtggaaaagctttctctcaa
tgctcagtatttattatacatatgagaagtcacactggtgagaaaccctatgtatgtagt
gaatgtgggaaagccttctctcagagttcatccctaaccgtacatatgcgaaatcataca
gctgagaaaccctatgaatgtaaggaatgtggaaaagccttcagcaggaaagaaaatctc
attacacatcagaaaattcacactggagagaaaccttatgaatgcagtgaatgtgggaaa
gcttttattcagatgtcaaacctcattcgacaccagagaattcatacgggtgagaaaccc
tatgcatgtacagtatgtggaaaagcctttagtcagaaatcaaacctcactgaacatgag
aaaattcatactggagagaaaccttatcattgtaatcaatgtgggaaagctttcagtcag
agacaaaatcttcttgagcatgaaaaaattcatactggagagaaaccattcaaatgtaat
gaatgtggtaaagccttctctcgaatctcatccctcactcttcatgtgagaagtcacaca
ggggagaaaccctatgaatgtaataaatgtgggaaagccttttctcagtgctcattactt
attatacatatgagaagtcatactggtgagaaaccctttgaatgtaatgaatgtgggaaa
gcattctctcaaagagcatccctttctatacataagagaggtcatacaggtgagagacac
caagtatattaa

DBGET integrated database retrieval system