KEGG   Homo sapiens (human): 374900Help
Entry
374900            CDS       T01001                                 

Gene name
ZNF568
Definition
(RefSeq) zinc finger protein 568
  KO
K09228  
KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    374900 (ZNF568)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.12
AA seq 644 aa AA seqDB search
MTSQSSVISNSCVTMERLSHMMERKAWCSQESALSEEEEDTTRPLETVTFKDVAVDLTQE
EWEQMKPAQRNLYRDVMLENYSNLVTVGCQVTKPDVIFKLEQEEEPWVMEEEMFGRHCPE
VWEVDEQIKKQQETLVRKVTSISKKILIKEKVIECKKVAKIFPLSSDIVTSRQSFYDCDS
LDKGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRH
ERIHAGEKPYECKECGKAFSRKENLITHQKIHTGEKPYKCNECGKAFIQMSNLIRHHRIH
TGEKPYACKDCWKAFSQKSNLIEHERIHTGEKPYECKECGKSFSQKQNLIEHEKIHTGEK
PYACNECGRAFSRMSSVTLHMRSHTGEKPYKCNKCGKAFSQCSVFIIHMRSHTGEKPYVC
SECGKAFSQSSSLTVHMRNHTAEKPYECKECGKAFSRKENLITHQKIHTGEKPYECSECG
KAFIQMSNLIRHQRIHTGEKPYACTVCGKAFSQKSNLTEHEKIHTGEKPYHCNQCGKAFS
QRQNLLEHEKIHTGEKPFKCNECGKAFSRISSLTLHVRSHTGEKPYECNKCGKAFSQCSL
LIIHMRSHTGEKPFECNECGKAFSQRASLSIHKRGHTGERHQVY
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcaatcttcagtgatcagcaatagctgtgtgacaatggagcgtttgagccac
atgatggaaaggaaagcttggtgttctcaagagtctgccctttccgaggaagaagaggat
acaaccaggcctcttgaaacagtgacatttaaggatgtggctgttgaccttacccaggag
gagtgggagcaaatgaaacctgctcaaagaaacttgtatcgagatgtgatgctggagaac
tacagcaacctagtcacagtgggctgtcaagtcaccaaaccggatgtgatattcaagttg
gagcaagaagaggagccctgggtgatggaggaagaaatgtttgggaggcactgtccagaa
gtttgggaagttgatgaacagatcaagaagcaacaggaaacacttgtgaggaaagtcaca
tccatctccaagaaaattctgataaaggaaaaagtcattgaatgtaaaaaagttgcgaaa
atatttcctctgagttcagacattgttacttcaagacaaagcttctatgactgtgactca
cttgataagggtttggaacataatttagacttacttagatatgagaaaggctgtgtaaga
gagaaacagagtaatgagtttgggaaaccattttaccattgtgcatcctatgttgtaacc
ccctttaagtgtaatcagtgtggacaagacttcagtcataaatttgacctcattagacat
gagcgaattcatgctggagagaaaccttacgaatgtaaagaatgtggaaaagccttcagt
aggaaggaaaatcttattacacatcagaaaattcatactggggaaaaaccgtataagtgt
aatgaatgtggaaaagctttcattcagatgtcaaaccttattagacaccacagaattcat
actggggagaaaccttatgcatgtaaggattgttggaaagccttcagtcagaaatcaaat
ctcattgaacatgagcgaattcacactggagagaaaccctatgaatgtaaggaatgtggg
aaatccttcagccagaagcaaaatcttattgagcacgagaaaattcatactggggagaaa
ccttatgcatgtaatgaatgtggtagagctttttctcgaatgtcatctgttacgctacat
atgagaagtcacacaggggagaaaccctataaatgtaataaatgtggaaaagctttctct
caatgctcagtatttattatacatatgagaagtcacactggtgagaaaccctatgtatgt
agtgaatgtgggaaagccttctctcagagttcatccctaaccgtacatatgcgaaatcat
acagctgagaaaccctatgaatgtaaggaatgtggaaaagccttcagcaggaaagaaaat
ctcattacacatcagaaaattcacactggagagaaaccttatgaatgcagtgaatgtggg
aaagcttttattcagatgtcaaacctcattcgacaccagagaattcatacgggtgagaaa
ccctatgcatgtacagtatgtggaaaagcctttagtcagaaatcaaacctcactgaacat
gagaaaattcatactggagagaaaccttatcattgtaatcaatgtgggaaagctttcagt
cagagacaaaatcttcttgagcatgaaaaaattcatactggagagaaaccattcaaatgt
aatgaatgtggtaaagccttctctcgaatctcatccctcactcttcatgtgagaagtcac
acaggggagaaaccctatgaatgtaataaatgtgggaaagccttttctcagtgctcatta
cttattatacatatgagaagtcatactggtgagaaaccctttgaatgtaatgaatgtggg
aaagcattctctcaaagagcatccctttctatacataagagaggtcatacaggtgagaga
caccaagtatattaa

DBGET integrated database retrieval system