KEGG   Homo sapiens (human): 3750Help
Entry
3750              CDS       T01001                                 

Gene name
KCND1, KV4.1
Definition
(RefSeq) potassium voltage-gated channel subfamily D member 1
  KO
K04891  
potassium voltage-gated channel Shal-related subfamily D member 1
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCND, Kv4.x (Shal)
   3750 (KCND1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.23
AA seq 647 aa AA seqDB search
MAAGLATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGSARRSSREQPCGERFPQAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLLVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRR
AIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggcctggccacgtggctgccttttgctcgggcagcagcagtgggctggctg
cccctggcccagcaacccctgcccccggcaccgggggtgaaggcatctcgaggagatgag
gttctggtggtgaacgtgagcggacggcgctttgagacttggaagaatacgctggaccgc
tacccagacaccttgctgggcagctcggagaaggaattcttctacgatgctgactcaggc
gagtacttcttcgatcgcgaccctgacatgttccgccatgtgctgaacttctaccgaacg
gggcggctgcattgcccacggcaggagtgcatccaggccttcgacgaagagctggctttc
tacggcctggttcccgagctagtcggtgactgctgccttgaagagtatcgggaccgaaag
aaggagaatgccgagcgcctggcagaggatgaggaggcagagcaggccggggacggccca
gccctgccagcaggcagctccctgcggcagcggctctggcgggccttcgagaatccacac
acgagcaccgcagccctcgttttctactatgtgaccggcttcttcatcgccgtgtcggtc
atcgccaatgtggtggagaccatcccatgccgcggctctgcacgcaggtcctcaagggag
cagccctgtggcgaacgcttcccacaggcctttttctgcatggacacagcctgtgtactc
atattcacaggtgaatacctcctgcggctgtttgccgcccccagccgttgccgcttcctg
cggagtgtcatgagcctcatcgacgtggtggccatcctgccctactacattgggcttttg
gtgcccaagaacgacgatgtctctggcgcctttgtcaccctgcgtgtgttccgggtgttt
cgcatcttcaagttctccaggcactcacagggcttgaggattctgggctacacactcaag
agctgtgcctctgagctgggctttctcctcttttccctaaccatggccatcatcatcttt
gccactgtcatgttttatgctgagaagggcacaaacaagaccaactttacaagcatccct
gcggccttctggtataccattgtcaccatgaccacgcttggctacggagacatggtgccc
agcaccattgctggcaagattttcgggtccatctgctcactcagtggcgtcttggtcatt
gccctgcctgtgccagtcattgtgtccaactttagccgcatctaccaccagaaccagcgg
gctgacaagcgccgagcacagcagaaggtgcgcttggcaaggatccgattggcaaagagt
ggtaccaccaatgccttcctgcagtacaagcagaatgggggccttgaggacagcggcagt
ggcgaggaacaggctctttgtgtcaggaaccgttctgcctttgaacagcaacatcaccac
ttgctgcactgtctagagaagacaacgtgccatgagttcacagatgagctcaccttcagt
gaagccctgggagccgtctcgccgggtggccgcaccagccgtagcacctctgtgtcttcc
cagccagtgggacccggaagcctgctgtcttcttgctgccctcgcagggccaagcgccgc
gccatccgccttgccaactccactgcctcagtcagccgtggcagcatgcaggagctggac
atgctggcagggctgcgcaggagccatgcccctcagagccgttccagcctcaatgccaag
ccccatgacagccttgacctgaactgcgacagccgggacttcgtggctgccattatcagc
atccctacccctcctgccaacaccccagatgagagccaaccttcctcccctggcggcggt
ggcagggccggcagcaccctcaggaactccagcctgggtaccccttgcctcttccccgag
actgtcaagatctcatccctgtga

DBGET integrated database retrieval system