KEGG   Homo sapiens (human): 3751Help
Entry
3751              CDS       T01001                                 

Gene name
KCND2, KV4.2, RK5
Definition
potassium voltage-gated channel, Shal-related subfamily, member 2
Orthology
K04892  
potassium voltage-gated channel Shal-related subfamily D member 2
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    3751 (KCND2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCND, Kv4.x (Shal)
   3751 (KCND2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q31
AA seq 630 aa AA seqDB search
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE
RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA
FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF
TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA
FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHH
LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI
PNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI
PTPPVTTPEGDDRPESPEYSGGNIVRVSAL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgggggtggcagcgtggctgccttttgcaagggcagcggctatcgggtggatg
cctgtggcctcggggcctatgccggctcccccgaggcaggagaggaaaaggacccaagat
gctctcattgtgctgaatgtgagtggcacccgcttccagacgtggcaggacaccctggaa
cgttacccagacactctactgggcagttctgagagggactttttctaccacccagaaact
cagcagtatttctttgaccgtgacccagacatcttccgccacatcctgaatttctaccgc
actgggaagctccactatcctcgccacgagtgcatctctgcttacgatgaagaactggcc
ttctttggcctcatcccggaaatcatcggcgactgctgttatgaggagtacaaggatcgc
aggcgagagaacgccgagcgcctgcaggacgacgcggataccgacaccgctggggagagc
gccttgcccaccatgactgcaaggcagagggtctggagggccttcgagaacccccacacc
agcacgatggccctggtgttctactatgtcacggggtttttcattgccgtctctgtcatc
gcgaatgtggtggaaacagtgccgtgcggatcaagcccaggtcacattaaagaactgccc
tgtggagagcggtatgctgtggccttcttctgcttggacacggcctgcgtcatgatcttc
acagttgagtatttgcttcgcctggctgcagcgcctagtcgttaccgttttgtgcgtagt
gtcatgagtatcatcgacgtggtggccatcctgccttattacattgggctggtgatgaca
gacaatgaggacgtcagcggagcctttgtcacactccgagtcttccgggtcttcaggatc
tttaagttttcccgccactctcaaggcctgcgcatcctggggtacacactgaagagttgt
gcctcagaattgggcttcttgcttttctcgctcaccatggctatcatcatcttcgctaca
gttatgttctacgcagagaaggggtcttcggctagcaagttcaccagcatccctgcagcc
ttctggtataccatcgtcaccatgacaacactagggtatggtgacatggtgccaaaaacc
atagcagggaagatttttggttctatctgttcgctgagtggggtcttggtcattgctcta
cctgttccggtgattgtatccaacttcagtcgcatctaccaccagaatcaacgagcagac
aaacgaagggcacaaaagaaagctagactggccaggatccgggcagccaaaagcggaagc
gcaaatgcttacatgcagagcaaacggaatggtttactcagtaatcagctgcagtcctca
gaggatgagcaggcttttgttagcaaatccggctccagctttgaaacccagcaccaccac
ctgcttcactgcctggaaaaaaccacgaatcacgagtttgtggacgaacaagtctttgaa
gaaagctgcatggaagttgcaactgttaatcgtccttcaagtcacagtccttcactgtct
tcacaacaaggagtcaccagcacctgctgttcacgacgacacaaaaaaacttttcgcatc
ccaaatgccaatgtatcaggaagccatcaaggtagtatacaagaactcagcacgattcag
atcagatgtgtggagagaacacctctgtctaacagccgatccagtttaaatgccaaaatg
gaagagtgtgttaaactaaactgtgaacaaccttatgtgactacagcaataataagcatc
ccaacacctccagtaaccacaccagaaggagacgataggccagaatcccctgagtactca
ggaggaaatattgtcagagtttctgctttgtaa

DBGET integrated database retrieval system