KEGG   Homo sapiens (human): 375189Help
Entry
375189            CDS       T01001                                 

Gene name
PFN4
Definition
profilin family, member 4
Orthology
K05759  
profilin
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    375189 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    375189 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    375189 (PFN4)
   05131 Shigellosis
    375189 (PFN4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   375189 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
2p23.3
AA seq 129 aa AA seqDB search
MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVNGFAKNPLQAR
REGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSICVEATESL
GDYLRKKGS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt
gcagccctcatcaaaatccaggagcggagcttgtgtgtagcatcaccaggtttcaatgta
acgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttgcaagcccga
agagaaggactgtatttcaagggaaaagattacagatgtgtccgggcagatgaatattct
ctttatgccaaaaatgagaacactggtgtggttgtcgtgaagacccatctgtatcttctg
gtagcaacttacactgagggcatgtatcctagcatctgtgtggaagccacagagagcctg
ggagactacctaagaaaaaaaggaagttaa

DBGET integrated database retrieval system