KEGG   Homo sapiens (human): 3752Help
Entry
3752              CDS       T01001                                 

Gene name
KCND3, BRGDA9, KCND3L, KCND3S, KSHIVB, KV4.3, SCA19, SCA22
Definition
(RefSeq) potassium voltage-gated channel subfamily D member 3
  KO
K04893  
potassium voltage-gated channel Shal-related subfamily D member 3
Organism
hsa  Homo sapiens (human)
Drug target
Flecainide [DG:DG00201]: 
Amiodarone [DG:DG00204]: 
Tedisamil [DG:DG00206]: 
Dronedarone [DG:DG00207]: 
Bepridil [DG:DG00333]: 
Other: 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCND, Kv4.x (Shal)
   3752 (KCND3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3
AA seq 655 aa AA seqDB search
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLL
HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHP
GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG
LRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggagttgcggcctggctgccttttgcccgggctgcggccatcgggtggatg
ccggtggccaactgccccatgcccctggccccggccgacaagaacaagcggcaggatgag
ctgattgtcctcaacgtgagtgggcggaggttccagacctggaggaccacgctggagcgc
tacccggacaccctgctgggcagcacggagaaggagttcttcttcaacgaggacaccaag
gagtacttcttcgaccgggaccccgaggtgttccgctgcgtgctcaacttctaccgcacg
gggaagctgcactacccgcgctacgagtgcatctctgcctacgacgacgagctggccttc
tacggcatcctcccggagatcatcggggactgctgctacgaggagtacaaggaccgcaag
agggagaacgccgagcggctcatggacgacaacgactcggagaacaaccaggagtccatg
ccctcgctcagcttccgccagaccatgtggcgggccttcgagaacccccacaccagcacg
ctggccctggtcttctactacgtgactggcttcttcatcgctgtctcggtcatcaccaac
gtggtggagacggtgccgtgcggcacggtcccgggcagcaaggagctgccgtgcggggag
cgctactcggtggccttcttctgcctggacacggcgtgcgtcatgatcttcaccgtggag
tacctcctgcggctcttcgcggctcccagccgctaccgcttcatccgcagcgtcatgagc
atcatcgacgtggtggccatcatgccctactacatcggtctggtcatgaccaacaacgag
gacgtgtccggcgccttcgtcacgctccgggtcttccgcgtcttcaggatcttcaagttt
tcccgccactcccagggcctgcggatcctgggctacacactgaagagctgtgcctccgaa
ctgggctttcttctcttctccctcaccatggccatcatcatctttgccactgtgatgttt
tatgccgagaagggctcctcggccagcaagttcacaagcatccctgcctcgttttggtac
accattgtcaccatgaccacactgggatacggagacatggtgcctaagacgattgcaggg
aagatcttcggctccatctgctccttgagtggcgtcctggtcattgccctgccagtccct
gtgattgtttccaactttagccggatttaccaccagaatcagagagctgataaacgcagg
gcacaaaagaaggcccgccttgccaggatccgtgtggccaaaacaggcagttcgaatgca
tacctgcacagcaagcgcaacgggctcctcaacgaggcgctggagctgacgggcacccca
gaagaggagcacatgggcaagaccacctcactcatcgagagccagcatcatcacctgctg
cactgcctggaaaaaaccactgggttgtcctatcttgtggatgatcccctgttatctgta
cgaacctccaccatcaagaaccacgagtttattgatgagcagatgtttgagcagaactgc
atggagagttcaatgcagaactacccatccacaagaagtccctcactgtccagccaccca
ggcctcactaccacctgctgctcccgtcgtagtaagaagaccacacacctgcccaattct
aacctgccagctactcgcctgcgcagcatgcaagagctcagcacgatccacatccagggc
agtgagcagccctccctcacaaccagtcgctccagccttaatttgaaagcagacgacgga
ctgagaccaaactgcaaaacatcccagatcaccacagccatcatcagcatccccactccc
ccagcgctaaccccagagggggaaagtcggccaccccctgccagcccaggccccaacacg
aacattccttccatagccagcaatgttgtcaaggtctccgccttgtaa

DBGET integrated database retrieval system