KEGG   Homo sapiens (human): 3754Help
Entry
3754              CDS       T01001                                 

Gene name
KCNF1, IK8, KCNF, KV5.1, kH1
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily F member 1
  KO
K04899  
potassium voltage-gated channel subfamily F member 1
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNF, Kv5.x
   3754 (KCNF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p25
AA seq 494 aa AA seqDB search
MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGY
DTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDL
KFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCP
ARVVAVLSFLLILVSSVVMCMGTIPELQVLDAEGNRVEHPTLENVETACIGWFTLEYLLR
LFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARI
FKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQS
FWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLE
TAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLL
TEEKHHRTRLQSCK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtccggggagcgcagcctcccggagccgggcagccagagctccgctgccagc
gacgacatagagatagtcgtcaacgtggggggcgtgcggcaggtgctgtacggggacctc
ctcagtcagtaccctgagacccggctggcggagctcatcaactgcttggctgggggctac
gacaccatcttctccctgtgcgacgactacgaccccggcaagcgcgagttctactttgac
agggacccggacgccttcaagtgtgtcatcgaggtgtactatttcggggaggtccacatg
aagaagggcatctgccccatctgcttcaagaacgagatggacttctggaaggtggacctc
aagttcctggacgactgttgcaagagccacctgagcgagaagcgcgaggagctggaggag
atcgcgcgccgcgtgcagctcatcctggacgacctgggcgtggacgcagccgagggccgc
tggcgccgctgccagaagtgcgtctggaagttcctggagaagcccgagtcgtcgtgcccg
gcgcgggtggtggccgtgctctccttcctgctcatcctcgtctcgtccgtggtcatgtgc
atgggcaccatccccgagctgcaggtgctggacgccgagggcaaccgcgtggagcacccg
acgctggagaacgtggagacggcgtgcattggctggttcaccctggagtacctgctgcgc
ctcttctcgtcacccaacaagctgcacttcgcgctgtccttcatgaacattgtggacgtg
ctggccatcctccccttctacgtgagcctcacgctcacgcacctgggtgcccgcatgatg
gagctgaccaacgtgcagcaggccgtgcaggcgctgcggatcatgcgcatcgcgcgcatc
ttcaagctggcccgccactcctcgggcctgcagaccctcacctatgccctcaagcgcagc
ttcaaggaactggggctgctgctcatgtacctggcagtgggtatcttcgtcttctctgcc
ctgggctacaccatggagcagagccatccagagaccctgtttaagagcatcccccagtcc
ttctggtgggccatcatcaccatgaccaccgtcggctacggcgacatctaccccaagacc
acgctgggcaagctcaacgcggccatcagcttcttgtgtggtgtcatcgccatcgccctg
cccatccaccccatcatcaacaactttgtcaggtactacaacaagcagcgcgtcctggag
accgcggccaagcacgagctggagctgatggaactcaactccagcagcgggggcgagggc
aagaccgggggctcccgcagtgacctggacaacctccctccagagcctgcggggaaggag
gcgccgagctgcagcagccggctgaagctctcccacagcgacaccttcatccccctcctg
accgaggagaagcaccacaggacccggctccagagttgcaagtga

DBGET integrated database retrieval system