KEGG   Homo sapiens (human): 3757Help
Entry
3757              CDS       T01001                                 

Gene name
KCNH2, ERG1, HERG, HERG1, Kv11.1, LQT2, SQT1
Definition
potassium voltage-gated channel, subfamily H (eag-related), member 2
Orthology
K04905  
potassium voltage-gated channel Eag-related subfamily H member 2
Organism
hsa  Homo sapiens (human)
Disease
H00720  
Long QT syndrome
H00725  
Short QT syndrome
Drug target
Aprindine: 
Flecainide: 
Amiodarone: 
Dofetilide: 
Ibutilide: 
Tedisamil: 
Dronedarone: 
Sotalol: 
Bepridil: 
Cocaine: 
Terfenadine: 
Other: 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNH, Kv10-12.x (Ether-a-go-go)
   3757 (KCNH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36.1
AA seq 1159 aa AA seqDB search
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSV
RSGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSP
PRSAPGQLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPP
RHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIA
PKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIY
TAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANE
EVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLD
RYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSS
GLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVS
AIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGF
PECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALY
FISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLE
VLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTE
QPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSS
PRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTP
SLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSA
VTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPG
QLGALTSQPLHRHGSDPGS
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcggaggggccacgtcgcgccgcagaacaccttcctggacaccatcatccgc
aagtttgagggccagagccgtaagttcatcatcgccaacgctcgggtggagaactgcgcc
gtcatctactgcaacgacggcttctgcgagctgtgcggctactcgcgggccgaggtgatg
cagcgaccctgcacctgcgacttcctgcacgggccgcgcacgcagcgccgcgctgccgcg
cagatcgcgcaggcactgctgggcgccgaggagcgcaaagtggaaatcgccttctaccgg
aaagatgggagctgcttcctatgtctggtggatgtggtgcccgtgaagaacgaggatggg
gctgtcatcatgttcatcctcaatttcgaggtggtgatggagaaggacatggtggggtcc
ccggctcatgacaccaaccaccggggcccccccaccagctggctggccccaggccgcgcc
aagaccttccgcctgaagctgcccgcgctgctggcgctgacggcccgggagtcgtcggtg
cggtcgggcggcgcgggcggcgcgggcgccccgggggccgtggtggtggacgtggacctg
acgcccgcggcacccagcagcgagtcgctggccctggacgaagtgacagccatggacaac
cacgtggcagggctcgggcccgcggaggagcggcgtgcgctggtgggtcccggctctccg
ccccgcagcgcgcccggccagctcccatcgccccgggcgcacagcctcaaccccgacgcc
tcgggctccagctgcagcctggcccggacgcgctcccgagaaagctgcgccagcgtgcgc
cgcgcctcgtcggccgacgacatcgaggccatgcgcgccggggtgctgcccccgccaccg
cgccacgccagcaccggggccatgcacccactgcgcagcggcttgctcaactccacctcg
gactccgacctcgtgcgctaccgcaccattagcaagattccccaaatcaccctcaacttt
gtggacctcaagggcgaccccttcttggcttcgcccaccagtgaccgtgagatcatagca
cctaagataaaggagcgaacccacaatgtcactgagaaggtcacccaggtcctgtccctg
ggcgccgacgtgctgcctgagtacaagctgcaggcaccgcgcatccaccgctggaccatc
ctgcattacagccccttcaaggccgtgtgggactggctcatcctgctgctggtcatctac
acggctgtcttcacaccctactcggctgccttcctgctgaaggagacggaagaaggcccg
cctgctaccgagtgtggctacgcctgccagccgctggctgtggtggacctcatcgtggac
atcatgttcattgtggacatcctcatcaacttccgcaccacctacgtcaatgccaacgag
gaggtggtcagccaccccggccgcatcgccgtccactacttcaagggctggttcctcatc
gacatggtggccgccatccccttcgacctgctcatcttcggctctggctctgaggagctg
atcgggctgctgaagactgcgcggctgctgcggctggtgcgcgtggcgcggaagctggat
cgctactcagagtacggcgcggccgtgctgttcttgctcatgtgcacctttgcgctcatc
gcgcactggctagcctgcatctggtacgccatcggcaacatggagcagccacacatggac
tcacgcatcggctggctgcacaacctgggcgaccagataggcaaaccctacaacagcagc
ggcctgggcggcccctccatcaaggacaagtatgtgacggcgctctacttcaccttcagc
agcctcaccagtgtgggcttcggcaacgtctctcccaacaccaactcagagaagatcttc
tccatctgcgtcatgctcattggctccctcatgtatgctagcatcttcggcaacgtgtcg
gccatcatccagcggctgtactcgggcacagcccgctaccacacacagatgctgcgggtg
cgggagttcatccgcttccaccagatccccaatcccctgcgccagcgcctcgaggagtac
ttccagcacgcctggtcctacaccaacggcatcgacatgaacgcggtgctgaagggcttc
cctgagtgcctgcaggctgacatctgcctgcacctgaaccgctcactgctgcagcactgc
aaacccttccgaggggccaccaagggctgccttcgggccctggccatgaagttcaagacc
acacatgcaccgccaggggacacactggtgcatgctggggacctgctcaccgccctgtac
ttcatctcccggggctccatcgagatcctgcggggcgacgtcgtcgtggccatcctgggg
aagaatgacatctttggggagcctctgaacctgtatgcaaggcctggcaagtcgaacggg
gatgtgcgggccctcacctactgtgacctacacaagatccatcgggacgacctgctggag
gtgctggacatgtaccctgagttctccgaccacttctggtccagcctggagatcaccttc
aacctgcgagataccaacatgatcccgggctcccccggcagtacggagttagagggtggc
ttcagtcggcaacgcaagcgcaagttgtccttccgcaggcgcacggacaaggacacggag
cagccaggggaggtgtcggccttggggccgggccgggcgggggcagggccgagtagccgg
ggccggccgggggggccgtggggggagagcccgtccagtggcccctccagccctgagagc
agtgaggatgagggcccaggccgcagctccagccccctccgcctggtgcccttctccagc
cccaggccccccggagagccgccgggtggggagcccctgatggaggactgcgagaagagc
agcgacacttgcaaccccctgtcaggcgccttctcaggagtgtccaacattttcagcttc
tggggggacagtcggggccgccagtaccaggagctccctcgatgccccgcccccaccccc
agcctcctcaacatccccctctccagcccgggtcggcggccccggggcgacgtggagagc
aggctggatgccctccagcgccagctcaacaggctggagacccggctgagtgcagacatg
gccactgtcctgcagctgctacagaggcagatgacgctggtcccgcccgcctacagtgct
gtgaccaccccggggcctggccccacttccacatccccgctgttgcccgtcagccccctc
cccaccctcaccttggactcgctttctcaggtttcccagttcatggcgtgtgaggagctg
cccccgggggccccagagcttccccaagaaggccccacacgacgcctctccctaccgggc
cagctgggggccctcacctcccagcccctgcacagacacggctcggacccgggcagttag

DBGET integrated database retrieval system