KEGG   Homo sapiens (human): 3757Help
Entry
3757              CDS       T01001                                 

Gene name
KCNH2, ERG-1, ERG1, H-ERG, HERG, HERG1, Kv11.1, LQT2, SQT1
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 2
  KO
K04905  potassium voltage-gated channel Eag-related subfamily H member 2
Organism
hsa  Homo sapiens (human)
Disease
H00720  Long QT syndrome
H00725  Short QT syndrome
Drug target
Ambasilide: D09758
Amiodarone (DG00204): D00636 D02910
Azimilide dihydrochloride: D03037
Bepridil (DG00333): D00631 D07520
Clofilium phosphate: D03547
Cocaine (DG00808): D00110 D02182
Dexsotalol hydrochloride: D03732
Dofetilide: D00647
Dronedarone (DG00207): D02537 D03914
Ibutilide (DG00205): D00648 D08060
Nifekalant hydrochloride: D01856
Sematilide hydrochloride: D04955
Sotalol (DG00307): D01026 D08525
Terfenadine: D00521
Terikalant: D09757
Trecetilide: D09759
Trecetilide fumarate: D06206
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNH, Kv10-12.x (Ether-a-go-go)
   3757 (KCNH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS PAS_3 PAS_4 PAS_8
Motif
Other DBs
NCBI-GeneID: 3757
NCBI-ProteinID: NP_000229
OMIM: 152427
HGNC: 6251
Ensembl: ENSG00000055118
Vega: OTTHUMG00000158341
Pharos: Q12809(Tclin)
UniProt: Q12809 Q15BH2 A0A090N8Q0
Structure
PDB: 

Jmol
Position
7q36.1
AA seq 1159 aa AA seqDB search
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSV
RSGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSP
PRSAPGQLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPP
RHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIA
PKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIY
TAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANE
EVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLD
RYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSS
GLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVS
AIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGF
PECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALY
FISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLE
VLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTE
QPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSS
PRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTP
SLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSA
VTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPG
QLGALTSQPLHRHGSDPGS
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcggaggggccacgtcgcgccgcagaacaccttcctggacaccatcatccgc
aagtttgagggccagagccgtaagttcatcatcgccaacgctcgggtggagaactgcgcc
gtcatctactgcaacgacggcttctgcgagctgtgcggctactcgcgggccgaggtgatg
cagcgaccctgcacctgcgacttcctgcacgggccgcgcacgcagcgccgcgctgccgcg
cagatcgcgcaggcactgctgggcgccgaggagcgcaaagtggaaatcgccttctaccgg
aaagatgggagctgcttcctatgtctggtggatgtggtgcccgtgaagaacgaggatggg
gctgtcatcatgttcatcctcaatttcgaggtggtgatggagaaggacatggtggggtcc
ccggctcatgacaccaaccaccggggcccccccaccagctggctggccccaggccgcgcc
aagaccttccgcctgaagctgcccgcgctgctggcgctgacggcccgggagtcgtcggtg
cggtcgggcggcgcgggcggcgcgggcgccccgggggccgtggtggtggacgtggacctg
acgcccgcggcacccagcagcgagtcgctggccctggacgaagtgacagccatggacaac
cacgtggcagggctcgggcccgcggaggagcggcgtgcgctggtgggtcccggctctccg
ccccgcagcgcgcccggccagctcccatcgccccgggcgcacagcctcaaccccgacgcc
tcgggctccagctgcagcctggcccggacgcgctcccgagaaagctgcgccagcgtgcgc
cgcgcctcgtcggccgacgacatcgaggccatgcgcgccggggtgctgcccccgccaccg
cgccacgccagcaccggggccatgcacccactgcgcagcggcttgctcaactccacctcg
gactccgacctcgtgcgctaccgcaccattagcaagattccccaaatcaccctcaacttt
gtggacctcaagggcgaccccttcttggcttcgcccaccagtgaccgtgagatcatagca
cctaagataaaggagcgaacccacaatgtcactgagaaggtcacccaggtcctgtccctg
ggcgccgacgtgctgcctgagtacaagctgcaggcaccgcgcatccaccgctggaccatc
ctgcattacagccccttcaaggccgtgtgggactggctcatcctgctgctggtcatctac
acggctgtcttcacaccctactcggctgccttcctgctgaaggagacggaagaaggcccg
cctgctaccgagtgtggctacgcctgccagccgctggctgtggtggacctcatcgtggac
atcatgttcattgtggacatcctcatcaacttccgcaccacctacgtcaatgccaacgag
gaggtggtcagccaccccggccgcatcgccgtccactacttcaagggctggttcctcatc
gacatggtggccgccatccccttcgacctgctcatcttcggctctggctctgaggagctg
atcgggctgctgaagactgcgcggctgctgcggctggtgcgcgtggcgcggaagctggat
cgctactcagagtacggcgcggccgtgctgttcttgctcatgtgcacctttgcgctcatc
gcgcactggctagcctgcatctggtacgccatcggcaacatggagcagccacacatggac
tcacgcatcggctggctgcacaacctgggcgaccagataggcaaaccctacaacagcagc
ggcctgggcggcccctccatcaaggacaagtatgtgacggcgctctacttcaccttcagc
agcctcaccagtgtgggcttcggcaacgtctctcccaacaccaactcagagaagatcttc
tccatctgcgtcatgctcattggctccctcatgtatgctagcatcttcggcaacgtgtcg
gccatcatccagcggctgtactcgggcacagcccgctaccacacacagatgctgcgggtg
cgggagttcatccgcttccaccagatccccaatcccctgcgccagcgcctcgaggagtac
ttccagcacgcctggtcctacaccaacggcatcgacatgaacgcggtgctgaagggcttc
cctgagtgcctgcaggctgacatctgcctgcacctgaaccgctcactgctgcagcactgc
aaacccttccgaggggccaccaagggctgccttcgggccctggccatgaagttcaagacc
acacatgcaccgccaggggacacactggtgcatgctggggacctgctcaccgccctgtac
ttcatctcccggggctccatcgagatcctgcggggcgacgtcgtcgtggccatcctgggg
aagaatgacatctttggggagcctctgaacctgtatgcaaggcctggcaagtcgaacggg
gatgtgcgggccctcacctactgtgacctacacaagatccatcgggacgacctgctggag
gtgctggacatgtaccctgagttctccgaccacttctggtccagcctggagatcaccttc
aacctgcgagataccaacatgatcccgggctcccccggcagtacggagttagagggtggc
ttcagtcggcaacgcaagcgcaagttgtccttccgcaggcgcacggacaaggacacggag
cagccaggggaggtgtcggccttggggccgggccgggcgggggcagggccgagtagccgg
ggccggccgggggggccgtggggggagagcccgtccagtggcccctccagccctgagagc
agtgaggatgagggcccaggccgcagctccagccccctccgcctggtgcccttctccagc
cccaggccccccggagagccgccgggtggggagcccctgatggaggactgcgagaagagc
agcgacacttgcaaccccctgtcaggcgccttctcaggagtgtccaacattttcagcttc
tggggggacagtcggggccgccagtaccaggagctccctcgatgccccgcccccaccccc
agcctcctcaacatccccctctccagcccgggtcggcggccccggggcgacgtggagagc
aggctggatgccctccagcgccagctcaacaggctggagacccggctgagtgcagacatg
gccactgtcctgcagctgctacagaggcagatgacgctggtcccgcccgcctacagtgct
gtgaccaccccggggcctggccccacttccacatccccgctgttgcccgtcagccccctc
cccaccctcaccttggactcgctttctcaggtttcccagttcatggcgtgtgaggagctg
cccccgggggccccagagcttccccaagaaggccccacacgacgcctctccctaccgggc
cagctgggggccctcacctcccagcccctgcacagacacggctcggacccgggcagttag

DBGET integrated database retrieval system