KEGG   Homo sapiens (human): 375775Help
Entry
375775            CDS       T01001                                 

Gene name
PNPLA7, C9orf111, NTE-R1, NTEL1
Definition
patatin-like phospholipase domain containing 7
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    375775 (PNPLA7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     375775 (PNPLA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.3
AA seq 1342 aa AA seqDB search
MEEEKDDSPQADFCLGTALHSWGLWFTEEGSPSTMLTGIAVGALLALALVGVLILFMFRR
LRQFRQAQPTPQYRFRKRDKVMFYGRKIMRKVTTLPNTLVENTALPRQRARKRTKVLSLA
KRILRFKKEYPALQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHIVFVQLQEGEHVFQPREPDPSICVVQDGRLEVCIQDTDGTEVVVKEVLAGDSVHS
LLSILDIITGHAAPYKTVSVRAAIPSTILRLPAAAFHGVFEKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNAESQAIPLVSVASVAAGKAKKQVFYGEEERLKKPPRLQESCD
SDHGGGRPAAAGPLLKRSHSVPAPSIRKQILEELEKPGAGDPDPSAPQGGPGSATSDLGM
ACDRARVFLHSDEHPGSSVASKSRKSVMVAEIPSTVSQHSESHTDETLASRKSDAIFRAA
KKDLLTLMKLEDSSLLDGRVALLHVPAGTVVSRQGDQDASILFVVSGLLHVYQRKIGSQE
DTCLFLTRPGEMVGQLAVLTGEPLIFTVKANRDCSFLSISKAHFYEIMRKQPTVVLGVAH
TVVKRMSSFVRQIDFALDWVEVEAGRAIYRQGDKSDCTYIMLSGRLRSVIRKDDGKKRLA
GEYGRGDLVGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGE
KILGSLQQGPVTGHQLGLPTEGSKWDLGNPAVNLSTVAVMPVSEEVPLTAFALELEHALS
AIGPTLLLTSDNIKRRLGSAALDSVHEYRLSSWLGQQEDTHRIVLYQADGTLTPWTQRCV
RQADCILIVGLGDQEPTVGELERMLESTAVRAQKQLILLHREEGPAPARTVEWLNMRSWC
SGHLHLCCPRRVFSRRSLPKLVEMYKHVFQRPPDRHSDFSRLARVLTGNAIALVLGGGGA
RGCAQVGVLKALAECGIPVDMVGGTSIGAFVGALYSEERNYSQMRIRAKQWAEGMTSLMK
AALDLTYPITSMFSGAGFNSSIFSVFKDQQIEDLWIPYFAITTDITASAMRVHTDGSLWW
YVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSRDETDLT
NYGDALSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEVVKSSDYCEYLRPPI
DSYSTLDFGKFNEICEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKPASAVLTCPNAS
FTDLAEIVSRIEPAKPAMVDDESDYQTEYEEELLDVPRDAYADFQSTSAQQGSDLEDESS
LRHRHPSLAFPKLSEGSSDQDG
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagaaagatgacagcccacaggctgacttctgcctgggcaccgccctgcac
tcttggggactgtggttcacggaggaaggttcaccgtccaccatgctgacggggattgca
gttggagccctcctggccctggccttggttggtgtcctcatccttttcatgttcagaagg
cttagacaatttcgacaagcacagcccactcctcagtaccggttccggaagagagacaaa
gtgatgttttacggccggaagatcatgaggaaggtgaccacactccccaacacccttgtg
gagaacactgccctgccccggcagcgggccaggaagaggaccaaggtgctgtctttggcc
aagaggattctgcgtttcaagaaggaatacccggccctgcagcccaaggagcccccgccc
tccctgctggaggccgacctcacggagtttgacgtgaagaattctcacctgccatcggaa
gttctgtacatgctgaaaaacgttcgggtcctgggccactttgagaagccgctgttcctg
gagctttgcaaacacatcgtctttgtgcagctgcaggaaggggagcacgtcttccagccc
agggagccggaccccagcatctgtgtggtgcaggacgggcggctggaggtctgcatccag
gacactgacggcaccgaggtggtggtgaaagaggttctggcgggagacagcgtccacagc
ctgctcagcatcctggacatcatcaccggccatgctgcaccttacaaaacggtctccgtc
cgcgcggccatcccgtccaccatcctccggcttccagctgcggcttttcatggagttttt
gagaaatatccggaaactctggtgagggtggtgcagatcatcatggtgcggctgcagagg
gtgacctttctggctctgcacaactacctcggcctgaccacagagctcttcaacgctgag
agccaggccatccctctcgtgtctgtagccagtgtggctgccgggaaggccaagaagcag
gtgttctatggcgaagaagagcggcttaaaaagccaccgcggctccaggagtcctgtgac
tcagatcacgggggcggccgcccggcagctgctgggcccctgctgaagaggagccactcc
gtccccgcgccttccattcgcaaacagatcttggaggagctggagaagcccggggcaggt
gaccctgacccttcggccccacaagggggcccaggcagtgccacttctgatctggggatg
gcatgtgaccgtgccagggtcttcctgcactcggacgagcaccccgggagctccgtggcc
agcaagtccaggaaaagcgtgatggttgcagagataccctccacggtctcccagcactca
gagagtcacacggatgagaccctggccagcaggaagtcggatgccatcttcagagctgcc
aagaaggacctgctcaccctgatgaagctggaagactcatctctgttggatggccgggtg
gcgcttctgcacgttcctgcaggcacggtggtgtcaaggcagggagaccaggacgccagc
atcctgttcgtggtctcggggctgctgcacgtgtaccagcggaagatcggcagccaggag
gacacctgcttgttcctcacgcgccccggggagatggtgggccagctggccgtgctcacc
ggggagcctctcatcttcaccgtcaaggccaacagggactgcagcttcctgtccatctcc
aaggcccacttctatgaaatcatgcggaagcagccgaccgtcgtcctgggtgtggcgcac
actgtggtgaagaggatgtcgtccttcgtgcggcaaatcgactttgccctggactgggtg
gaggtggaggccgggcgagcaatatacaggcagggggacaagtccgactgcacgtacatc
atgctcagcggccggctgcgctctgtgatccggaaggatgatgggaagaagcgcctggcc
ggggagtacggccgaggagacctcgtcggcgtggtggagacactgacccaccaggcccgg
gcgaccacggtgcatgccgttcgggactcagaattggccaagctgccggcaggagccctc
acgtccatcaagcgcaggtacccacaggtggtgactcggctgattcatctcttgggtgag
aagatcctgggcagcctccagcagggacctgtgacaggccaccagcttgggctccccacg
gagggcagcaagtgggacttggggaacccggctgtcaacctgtccacggtggcagtgatg
cccgtgtcagaggaagtgcccctcaccgccttcgccctggagctggagcatgccctcagc
gccatcggcccgaccctgctgctgactagtgacaacataaaacggcgccttggctccgct
gccctggacagtgttcacgagtaccggctgtccagctggctggggcagcaggaggacacc
cacaggatcgtgctctaccaggcagatggcacgctcacaccctggacccagcgctgcgtg
cgccaggccgactgcatcctcatcgtgggcctgggtgaccaggagcccacagtgggcgag
ctggagcggatgctggagagcacagctgtgcgtgcccagaagcagctgatcctgctgcac
agggaggagggcccggcgccagcgcgcaccgtggagtggctcaacatgcggagctggtgc
tccggccacctgcacctctgctgcccgcgccgcgtcttctccaggaggagcctgcccaag
ctggtggagatgtacaagcatgtcttccagcggcccccggaccgacactcagacttctcc
cgcctggcgagggtgctgacgggcaacgccattgccctggtgcttgggggagggggagca
agaggctgtgcccaggtgggcgttctcaaggccttggcggagtgcggcatccctgtggac
atggtgggaggcacgtccatcggggccttcgtgggtgccctgtactctgaggagcggaac
tacagccagatgcggatccgggccaagcagtgggccgagggcatgacgtccttgatgaag
gccgcgctggacctcacctaccccatcacgtccatgttctccggagccggcttcaacagc
agcatcttcagcgtcttcaaggaccagcagatcgaggacctgtggattccttatttcgcc
atcaccaccgacatcacagcctcggccatgcgggtccacaccgacggctccctgtggtgg
tacgtgcgtgccagcatgtccctgtccggttacatgccccctctctgtgacccgaaggac
ggacacctgctgatggacgggggctacatcaacaacctcccagcggatgtggcccggtcc
atgggggcaaaagtggtgatcgccattgacgtgggcagccgagatgagacggacctcacc
aactatggggatgcgctgtctgggtggtggctgctgtggaaacgctggaaccccttggcc
acgaaagtcaaggtgttgaacatggcagagattcagacgcgcctggcctacgtgtgttgc
gtgcggcagctggaggtggtgaagagcagtgactactgcgagtacctgcgcccccccatc
gacagctacagcaccctggacttcggcaagttcaacgagatctgcgaagtgggctaccag
cacgggcgcacggtgtttgacatctggggccgcagcggcgtgctggagaagatgctccgc
gaccagcaggggccgagcaagaagcccgcgagtgcggtcctcacctgtcccaacgcctcc
ttcacggaccttgccgaaattgtgtctcgcattgagcccgccaagcccgccatggtggat
gacgaatctgactaccagacggagtacgaggaggagctgctggacgtccccagggatgca
tacgcagacttccagagcacctcagcccagcagggctcagacttggaggacgagtcctca
ctgcggcatcgacaccccagtctggctttcccaaaactgtctgagggctcctctgaccag
gacgggtag

DBGET integrated database retrieval system