KEGG   Homo sapiens (human): 375790Help
Entry
375790            CDS       T01001                                 

Gene name
AGRN, CMS8, CMSPPD
Definition
(RefSeq) agrin
  KO
K06254  
agrin
Organism
hsa  Homo sapiens (human)
Pathway
ECM-receptor interaction
Disease
H00770  
Congenital myasthenic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    375790 (AGRN)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/2 subfamily
    NCAM; neural cell adhesion molecule [KO:K06491]
     375790 (AGRN)
   Enzymatic CD
    PTPRS; receptor-type tyrosine-protein phosphatase S [KO:K06778]
     375790 (AGRN)
  Others
   CXADR, CAR; coxsackievirus and adenovirus receptor [KO:K06788]
    375790 (AGRN)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   375790 (AGRN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.33
AA seq 2045 aa AA seqDB search
MAGRSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPV
QHTYSCKVRVWRYLKGKDLVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPA
PPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFG
AVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRG
PCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLR
RACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDD
GVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVT
CDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCA
VKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQC
RFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCE
TCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEAR
AGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGS
DGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITA
ARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDG
RSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPAT
CAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQ
ISIQSLGPCQEAVAPSTHPTSASVTVTTPGLLLSQALPAPPGALPLAPSSTAHSQTTPPP
SSRPRTTASVPRTTVWPVLTVPPTAPSPAPSLVASAFGESGSTDGSSDEELSGDQEASGG
GSGGLEPLEGSSVATPGPPVERASCYNSALGCCSDGKTPSLDAEGSNCPATKVFQGVLEL
EGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSV
RAIVDVHFDPTTAFRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFITGA
TSGAIAAGATARATTASRLPSSAVTPRAPHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPG
RRPPAPQQPPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGR
SFLAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGP
AVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPE
DQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHG
GAPCQNLEAGRFHCQCPPGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGRE
GTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYN
GQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRV
GDGPRVLGESPVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLT
PEHVLRQVDVTSFAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKS
AGDVDTLAFDGRTFVEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYVA
LAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPL
GATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELR
PCPTP
NT seq 6138 nt NT seq  +upstreamnt  +downstreamnt
atggccggccggtcccacccgggcccgctgcggccgctgctgccgctccttgtggtggcc
gcgtgcgtcctgcccggagccggcgggacatgcccggagcgcgcgctggagcggcgcgag
gaggaggcgaacgtggtgctcaccgggacggtggaggagatcctcaacgtggacccggtg
cagcacacgtactcctgcaaggttcgggtctggcggtacttgaagggcaaagacctggtg
gcccgggagagcctgctggacggcggcaacaaggtggtgatcagcggctttggagacccc
ctcatctgtgacaaccaggtgtccactggggacaccaggatcttctttgtgaaccctgca
cccccatacctgtggccagcccacaagaacgagctgatgctcaactccagcctcatgcgg
atcaccctgcggaacctggaggaggtggagttctgtgtggaagataaacccgggacccac
ttcactccagtgcctccgacgcctcctgatgcgtgccggggaatgctgtgcggcttcggc
gccgtgtgcgagcccaacgcggaggggccgggccgggcgtcctgcgtctgcaagaagagc
ccgtgccccagcgtggtggcgcctgtgtgtgggtcggacgcctccacctacagcaacgaa
tgcgagctgcagcgggcgcagtgcagccagcagcgccgcatccgcctgctcagccgcggg
ccgtgcggctcgcgggacccctgctccaacgtgacctgcagcttcggcagcacctgtgcg
cgctcggccgacgggctgacggcctcgtgcctgtgccccgcgacctgccgtggcgccccc
gaggggaccgtctgcggcagcgacggcgccgactaccccggcgagtgccagctcctgcgc
cgcgcctgcgcccgccaggagaatgtcttcaagaagttcgacggcccttgtgacccctgt
cagggcgccctccctgacccgagccgcagctgccgtgtgaacccgcgcacgcggcgccct
gagatgctcctacggcccgagagctgccctgcccggcaggcgccagtgtgtggggacgac
ggagtcacctacgaaaacgactgtgtcatgggccgatcgggggccgcccggggtctcctc
ctgcagaaagtgcgctccggccagtgccagggtcgagaccagtgcccggagccctgccgg
ttcaatgccgtgtgcctgtcccgccgtggccgtccccgctgctcctgcgaccgcgtcacc
tgtgacggggcctacaggcccgtgtgtgcccaggacgggcgcacgtatgacagtgattgc
tggcggcagcaggctgagtgccggcagcagcgtgccatccccagcaagcaccagggcccg
tgtgaccaggccccgtccccatgcctcggggtgcagtgtgcatttggggcgacgtgtgct
gtgaagaacgggcaggcagcgtgtgaatgcctgcaggcgtgctcgagcctctacgatcct
gtgtgcggcagcgacggcgtcacatacggcagcgcgtgcgagctggaggccacggcctgt
accctcgggcgggagatccaggtggcgcgcaaaggaccctgtgaccgctgcgggcagtgc
cgctttggagccctgtgcgaggccgagaccgggcgctgcgtgtgcccctctgaatgcgtg
gctttggcccagcccgtgtgtggctccgacgggcacacgtaccccagcgagtgcatgctg
cacgtgcacgcctgcacacaccagatcagcctgcacgtggcctcagctggaccctgtgag
acctgtggagatgccgtgtgtgcttttggggctgtgtgctccgcagggcagtgtgtgtgt
ccccggtgtgagcaccccccgcccggccccgtgtgtggcagcgacggtgtcacctacggc
agtgcctgcgagctacgggaagccgcctgcctccagcagacacagatcgaggaggcccgg
gcagggccgtgcgagcaggccgagtgcggttccggaggctctggctctggggaggacggt
gactgtgagcaggagctgtgccggcagcgcggtggcatctgggacgaggactcggaggac
gggccgtgtgtctgtgacttcagctgccagagtgtcccaggcagcccggtgtgcggctca
gatggggtcacctacagcaccgagtgtgagctgaagaaggccaggtgtgagtcacagcga
gggctctacgtagcggcccagggagcctgccgaggccccaccttcgccccgctgccgcct
gtggcccccttacactgtgcccagacgccctacggctgctgccaggacaatatcaccgca
gcccggggcgtgggcctggctggctgccccagtgcctgccagtgcaacccccatggctct
tacggcggcacctgtgacccagccacaggccagtgctcctgccgcccaggtgtggggggc
ctcaggtgtgaccgctgtgagcctggcttctggaactttcgaggcatcgtcaccgatggc
cggagtggctgtacaccctgcagctgtgatccccaaggcgccgtgcgggatgactgtgag
cagatgacggggctgtgctcgtgtaagcccggggtggctggacccaagtgtgggcagtgt
ccagacggccgtgccctgggccccgcgggctgtgaagctgacgcttctgcgcctgcgacc
tgtgcggagatgcgctgtgagttcggtgcgcggtgcgtggaggagtctggctcagcccac
tgtgtctgcccgatgctcacctgtccagaggccaacgctaccaaggtctgtgggtcagat
ggagtcacatacggcaacgagtgtcagctgaagaccatcgcctgccgccagggcctgcaa
atctctatccagagcctgggcccgtgccaggaggctgttgctcccagcactcacccgaca
tctgcctccgtgactgtgaccaccccagggctcctcctgagccaggcactgccggccccc
cccggcgccctccccctggctcccagcagtaccgcacacagccagaccacccctccgccc
tcatcacgacctcggaccactgccagcgtccccaggaccaccgtgtggcccgtgctgacg
gtgccccccacggcaccctcccctgcacccagcctggtggcgtccgcctttggtgaatct
ggcagcactgatggaagcagcgatgaggaactgagcggggaccaggaggccagtgggggt
ggctctggggggctcgagcccttggagggcagcagcgtggccacccctgggccacctgtc
gagagggcttcctgctacaactccgcgttgggctgctgctctgatgggaagacgccctcg
ctggacgcagagggctccaactgccccgccaccaaggtgttccagggcgtcctggagctg
gagggcgtcgagggccaggagctgttctacacgcccgagatggctgaccccaagtcagaa
ctgttcggggagacagccaggagcattgagagcaccctggacgacctcttccggaattca
gacgtcaagaaggattttcggagtgtccgcttgcgggacctggggcccggcaaatccgtc
cgcgccattgtggatgtgcactttgaccccaccacagccttcagggcacccgacgtggcc
cgggccctgctccggcagatccaggtgtccaggcgccggtccttgggggtgaggcggccg
ctgcaggagcacgtgcgatttatggactttgactggtttcctgcgtttatcacgggggcc
acgtcaggagccattgctgcgggagccacggccagagccaccactgcatcgcgcctgccg
tcctctgctgtgacccctcgggccccgcaccccagtcacacaagccagcccgttgccaag
accacggcagcccccaccacacgtcggccccccaccactgcccccagccgtgtgcccgga
cgtcggcccccggccccccagcagcctccaaagccctgtgactcacagccctgcttccac
ggggggacctgccaggactgggcattgggcgggggcttcacctgcagctgcccggcaggc
aggggaggcgccgtctgtgagaaggtgcttggcgcccctgtgccggccttcgagggccgc
tccttcctggccttccccactctccgcgcctaccacacgctgcgcctggcactggaattc
cgggcgctggagcctcaggggctgctgctgtacaatggcaacgcccggggcaaggacttc
ctggcattggcgctgctagatggccgcgtgcagctcaggtttgacacaggttcggggccg
gcggtgctgaccagtgccgtgccggtagagccgggccagtggcaccgcctggagctgtcc
cggcactggcgccggggcaccctctcggtggatggtgagacccctgttctgggcgagagt
cccagtggcaccgacggcctcaacctggacacagacctctttgtgggcggcgtacccgag
gaccaggctgccgtggcgctggagcggaccttcgtgggcgccggcctgagggggtgcatc
cgtttgctggacgtcaacaaccagcgcctggagcttggcattgggccgggggctgccacc
cgaggctctggcgtgggcgagtgcggggaccacccctgcctgcccaacccctgccatggc
ggggccccatgccagaacctggaggctggaaggttccattgccagtgcccgcccggccgc
gtcggaccaacctgtgccgatgagaagagcccctgccagcccaacccctgccatggggcg
gcgccctgccgtgtgctgcccgagggtggtgctcagtgcgagtgccccctggggcgtgag
ggcaccttctgccagacagcctcggggcaggacggctctgggcccttcctggctgacttc
aacggcttctcccacctggagctgagaggcctgcacacctttgcacgggacctgggggag
aagatggcgctggaggtcgtgttcctggcacgaggccccagcggcctcctgctctacaac
gggcagaagacggacggcaagggggacttcgtgtcgctggcactgcgggaccgccgcctg
gagttccgctacgacctgggcaagggggcagcggtcatcaggagcagggagccagtcacc
ctgggagcctggaccagggtctcactggagcgaaacggccgcaagggtgccctgcgtgtg
ggcgacggcccccgtgtgttgggggagtccccggttccgcacaccgtcctcaacctgaag
gagccgctctacgtagggggcgctcccgacttcagcaagctggcccgtgctgctgccgtg
tcctctggcttcgacggtgccatccagctggtctccctcggaggccgccagctgctgacc
ccggagcacgtgctgcggcaggtggacgtcacgtcctttgcaggtcacccctgcacccgg
gcctcaggccacccctgcctcaatggggcctcctgcgtcccgagggaggctgcctatgtg
tgcctgtgtcccgggggattctcaggaccgcactgcgagaaggggctggtggagaagtca
gcgggggacgtggataccttggcctttgacgggcggacctttgtcgagtacctcaacgct
gtgaccgagagcgagaaggcactgcagagcaaccactttgaactgagcctgcgcactgag
gccacgcaggggctggtgctctggagtggcaaggccacggagcgggcagactatgtggca
ctggccattgtggacgggcacctgcaactgagctacaacctgggctcccagcccgtggtg
ctgcgttccaccgtgcccgtcaacaccaaccgctggttgcgggtcgtggcacatagggag
cagagggaaggttccctgcaggtgggcaatgaggcccctgtgaccggctcctccccgctg
ggcgccacgcagctggacactgatggagccctgtggcttgggggcctgccggagctgccc
gtgggcccagcactgcccaaggcctacggcacaggctttgtgggctgcttgcgggacgtg
gtggtgggccggcacccgctgcacctgctggaggacgccgtcaccaagccagagctgcgg
ccctgccccaccccatga

DBGET integrated database retrieval system