KEGG   Homo sapiens (human): 3758Help
Entry
3758              CDS       T01001                                 

Gene name
KCNJ1, KIR1.1, ROMK, ROMK1
Definition
potassium inwardly-rectifying channel, subfamily J, member 1
Orthology
K04995  
potassium inwardly-rectifying channel subfamily J member 1
Organism
hsa  Homo sapiens (human)
Pathway
Aldosterone-regulated sodium reabsorption
Gastric acid secretion
Disease
H00239  
Bartter syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    3758 (KCNJ1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3758 (KCNJ1)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   3758 (KCNJ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q24
AA seq 391 aa AA seqDB search
MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttccagtcggaatgtgtttgacacgttgatcagggtgttgacagaaagtatg
ttcaaacatcttcggaaatgggtcgtcactcgcttttttgggcattctcggcaaagagca
aggctagtctccaaagatggaaggtgcaacatagaatttggcaatgtggaggcacagtca
aggtttatattctttgtggacatctggacaacggtacttgacctcaagtggagatacaaa
atgaccattttcatcacagccttcttggggagttggtttttctttggtctcctgtggtat
gcagtagcgtacattcacaaagacctcccggaattccatccttctgccaatcacactccc
tgtgtggagaatattaatggcttgacctcagcttttctgttttctctggagactcaagtg
accattggatatggattcaggtgtgtgacagaacagtgtgccactgccatttttctgctt
atctttcagtctatacttggagttataatcaattctttcatgtgtggggccatcttagcc
aagatctccaggcccaaaaaacgtgccaagaccattacgttcagcaagaacgcagtgatc
agcaaacggggagggaagctttgcctcctaatccgagtggctaatctcaggaagagcctt
cttattggcagtcacatttatggaaagcttctgaagaccacagtcactcctgaaggagag
accattattttggaccagatcaatatcaactttgtagttgacgctgggaatgaaaattta
ttcttcatctccccattgacaatttaccatgtcattgatcacaacagccctttcttccac
atggcagcggagacccttctccagcaggactttgaattagtggtgtttttagatggcaca
gtggagtccaccagtgctacctgccaagtccggacatcctatgtcccagaggaggtgctt
tggggctaccgttttgctcccatagtatccaagacaaaggaagggaaataccgagtggat
ttccataactttagcaagacagtggaagtggagacccctcactgtgccatgtgcctttat
aatgagaaagatgttagagccaggatgaagagaggctatgacaaccccaacttcatcttg
tcagaagtcaatgaaacagatgacaccaaaatgtaa

DBGET integrated database retrieval system