KEGG   Homo sapiens (human): 3760Help
Entry
3760              CDS       T01001                                 

Gene name
KCNJ3, GIRK1, KGA, KIR3.1
Definition
potassium inwardly-rectifying channel, subfamily J, member 3
Orthology
K04997  
potassium inwardly-rectifying channel subfamily J member 3
Organism
hsa  Homo sapiens (human)
Pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Estrogen signaling pathway
Oxytocin signaling pathway
Morphine addiction
Drug target
Amiodarone: 
Dronedarone: 
Bepridil: 
Class
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24.1
AA seq 235 aa AA seqDB search
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcactccgaaggaaatttggggacgattatcaggtagtgaccacatcgtccagc
ggctcgggcttgcagccccaggggccaggccaggaccctcagcagcagcttgtgcccaag
aagaagcggcagcggttcgtggacaagaacggccggtgcaatgtacagcacggcaacctg
ggcagcgagacaagccgctacctctcggacctcttcaccacgctggtggacctcaagtgg
cgctggaacctcttcatcttcattctcacctacaccgtggcctggcttttcatggcgtcc
atgtggtgggtgatcgcctacactcggggcgacctgaacaaagcccacgtcggtaactac
acgccttgcgtggccaatgtctataacttcccttctgccttcctcttcttcatcgagacg
gaggccaccatcggctatggctaccgatacatcacagacaagtgccccgagggcatcatc
ctcttcctcttccagtccatcctgggctccatcgtggacgccttcctcatcggctgcatg
ttcatcaagatgtcccagcccaagaagcgcgccgagaccctcatgttcagcgagcacgcg
gtgatctccatgagggacggaaaactcacgcttatgttccgggtgggcaacctgcgcaac
agccacatggtctccgcgcagattcgctgcaagctgctcaaaggatga

DBGET integrated database retrieval system