KEGG   Homo sapiens (human): 3760Help
Entry
3760              CDS       T01001                                 

Gene name
KCNJ3, GIRK1, KGA, KIR3.1
Definition
potassium inwardly-rectifying channel, subfamily J, member 3
Orthology
K04997  
potassium inwardly-rectifying channel subfamily J member 3
Organism
hsa  Homo sapiens (human)
Pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Estrogen signaling pathway
Oxytocin signaling pathway
Morphine addiction
Drug target
Amiodarone: 
Dronedarone: 
Bepridil: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    3760 (KCNJ3)
   04921 Oxytocin signaling pathway
    3760 (KCNJ3)
  Nervous system
   04724 Glutamatergic synapse
    3760 (KCNJ3)
   04725 Cholinergic synapse
    3760 (KCNJ3)
   04728 Dopaminergic synapse
    3760 (KCNJ3)
   04726 Serotonergic synapse
    3760 (KCNJ3)
   04723 Retrograde endocannabinoid signaling
    3760 (KCNJ3)
  Environmental adaptation
   04713 Circadian entrainment
    3760 (KCNJ3)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    3760 (KCNJ3)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   3760 (KCNJ3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24.1
AA seq 235 aa AA seqDB search
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcactccgaaggaaatttggggacgattatcaggtagtgaccacatcgtccagc
ggctcgggcttgcagccccaggggccaggccaggaccctcagcagcagcttgtgcccaag
aagaagcggcagcggttcgtggacaagaacggccggtgcaatgtacagcacggcaacctg
ggcagcgagacaagccgctacctctcggacctcttcaccacgctggtggacctcaagtgg
cgctggaacctcttcatcttcattctcacctacaccgtggcctggcttttcatggcgtcc
atgtggtgggtgatcgcctacactcggggcgacctgaacaaagcccacgtcggtaactac
acgccttgcgtggccaatgtctataacttcccttctgccttcctcttcttcatcgagacg
gaggccaccatcggctatggctaccgatacatcacagacaagtgccccgagggcatcatc
ctcttcctcttccagtccatcctgggctccatcgtggacgccttcctcatcggctgcatg
ttcatcaagatgtcccagcccaagaagcgcgccgagaccctcatgttcagcgagcacgcg
gtgatctccatgagggacggaaaactcacgcttatgttccgggtgggcaacctgcgcaac
agccacatggtctccgcgcagattcgctgcaagctgctcaaaggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system