KEGG   Homo sapiens (human): 3761Help
Entry
3761              CDS       T01001                                 

Gene name
KCNJ4, HIR, HIRK2, HRK1, IRK-3, IRK3, Kir2.3
Definition
potassium inwardly-rectifying channel, subfamily J, member 4
Orthology
K04998  
potassium inwardly-rectifying channel subfamily J member 4
Organism
hsa  Homo sapiens (human)
Pathway
Cholinergic synapse
Oxytocin signaling pathway
Class
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 445 aa AA seqDB search
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNG
FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKK
RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR
DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT
TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV
LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG
SHLDLERMQASLPLDNISYRRESAI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcacggacacagccgcaacggccaggcccacgtgccccggcggaagcgccgcaaccgc
ttcgtcaagaagaacggccaatgcaacgtgtacttcgccaacctgagcaacaagtcgcag
cgctacatggcggacatcttcaccacctgcgtggacacgcgctggcgctacatgctcatg
atcttctccgcggccttccttgtctcctggctctttttcggcctcctcttctggtgtatc
gccttcttccacggtgacctggaggccagcccaggggtgcctgcggcggggggcccggcg
gcgggtggtggcggagcagccccggtggcccccaagccctgcatcatgcacgtgaacggc
ttcctgggtgccttcctgttctcggtggagacgcagacgaccatcggctatgggttccgg
tgcgtgacagaggagtgcccgctggcagtcatcgctgtggtggtccagtccatcgtgggc
tgcgtcatcgactccttcatgattggcaccatcatggccaagatggcgcggcccaagaag
cgggcgcagacgttgctgttcagccaccacgcggtcatttcggtgcgcgacggcaagctc
tgcctcatgtggcgcgtgggcaacctgcgcaagagccacattgtggaggcccacgtgcgg
gcccagctcatcaagccctacatgacccaggagggcgagtacctgcccctggaccagcgg
gacctcaacgtgggctatgacatcggcctggaccgcatcttcctggtgtcgcccatcatc
attgtccacgagatcgacgaggacagcccgctttatggcatgggcaaggaggagctggag
tcggaggactttgagatcgtggtcatcctggagggcatggtggaggccacggccatgacc
acccaggcccgcagctcctacctggccagcgagatcctgtggggccaccgctttgagcct
gtggtcttcgaggagaagagccactacaaggtggactactcacgttttcacaagacctac
gaggtggccggcacgccctgctgctcggcccgggagctgcaggagagtaagatcaccgtg
ctgcccgccccaccgccccctcccagtgccttctgctacgagaacgagctggcccttatg
agccaggaggaagaggagatggaggaggaggcagctgcggcggccgcggtggccgcaggc
ctgggcctggaggcgggttccaaggaggaggcgggcatcatccggatgctggagttcggc
agccacctggacctggagcgcatgcaggcttccctcccgctggacaacatctcctaccgc
agggagtctgccatctga

DBGET integrated database retrieval system