KEGG   Homo sapiens (human): 3762Help
Entry
3762              CDS       T01001                                 

Gene name
KCNJ5, CIR, GIRK4, KATP1, KIR3.4, LQT13
Definition
potassium inwardly-rectifying channel, subfamily J, member 5
Orthology
K04999  
potassium inwardly-rectifying channel subfamily J member 5
Organism
hsa  Homo sapiens (human)
Pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Serotonergic synapse
Dopaminergic synapse
Estrogen signaling pathway
Oxytocin signaling pathway
Morphine addiction
Disease
H00720  
Long QT syndrome
Drug target
Amiodarone: 
Dronedarone: 
Bepridil: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    3762 (KCNJ5)
   04921 Oxytocin signaling pathway
    3762 (KCNJ5)
  Nervous system
   04728 Dopaminergic synapse
    3762 (KCNJ5)
   04726 Serotonergic synapse
    3762 (KCNJ5)
   04723 Retrograde endocannabinoid signaling
    3762 (KCNJ5)
  Environmental adaptation
   04713 Circadian entrainment
    3762 (KCNJ5)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    3762 (KCNJ5)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   3762 (KCNJ5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
11q24
AA seq 419 aa AA seqDB search
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgattctaggaatgccatgaaccaggacatggagattggagtcactccctgg
gaccccaagaagattccaaaacaggcccgcgattatgtccccattgccacagaccgtacg
cgcctgctggccgagggcaagaagccacgccagcgctacatggagaagagtggcaagtgc
aacgtgcaccacggcaacgtccaggagacctaccggtacctgagtgacctcttcaccacc
ctggtggacctcaagtggcgcttcaacttgctcgtcttcaccatggtttacactgtcacc
tggctgttcttcggcttcatttggtggctcattgcttatatccggggtgacctggaccat
gttggcgaccaagagtggattccttgtgttgaaaacctcagtggcttcgtgtccgctttc
ctgttctccattgagaccgaaacaaccattgggtatggcttccgagtcatcacagagaag
tgtccagaggggattatactcctcttggtccaggccatcctgggctccatcgtcaatgcc
ttcatggtggggtgcatgtttgtcaagatcagccagcccaagaagagagcggagaccctc
atgttttccaacaacgcagtcatctccatgcgggacgagaagctgtgcctcatgttccgg
gtgggcgacctccgcaactcccacatcgtggaggcctccatccgggccaagctcatcaag
tcccggcagaccaaagagggggagttcatccccctgaaccagacagacatcaacgtgggc
tttgacacgggcgacgaccgcctcttccttgtgtctcctctgatcatctcccatgagatc
aaccagaagagccctttctgggagatgtctcaggctcagctgcatcaggaagagtttgaa
gttgtggtcattctagaagggatggtggaagccacaggcatgacctgccaagcccggagc
tcctacatggatacagaggtgctctggggccaccgattcacaccagtcctcaccttggaa
aagggcttctatgaggtggactacaacaccttccatgatacctatgagaccaacacaccc
agctgctgtgccaaggagctggcagaaatgaagagggaaggccggctcctccagtacctc
cccagccccccactgctggggggctgtgctgaggcagggctggatgcagaggctgagcag
aatgaagaagatgagcccaaggggctgggtgggtccagggaggccaggggctcggtgtga

DBGET integrated database retrieval system