KEGG   Homo sapiens (human): 3763Help
Entry
3763              CDS       T01001                                 

Gene name
KCNJ6, BIR1, GIRK-2, GIRK2, KATP-2, KATP2, KCNJ7, KIR3.2, hiGIRK2
Definition
potassium inwardly-rectifying channel, subfamily J, member 6
Orthology
K05000  
potassium inwardly-rectifying channel subfamily J member 6
Organism
hsa  Homo sapiens (human)
Pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Estrogen signaling pathway
Oxytocin signaling pathway
Morphine addiction
Drug target
Verapamil: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    3763 (KCNJ6)
   04921 Oxytocin signaling pathway
    3763 (KCNJ6)
  Nervous system
   04727 GABAergic synapse
    3763 (KCNJ6)
   04725 Cholinergic synapse
    3763 (KCNJ6)
   04728 Dopaminergic synapse
    3763 (KCNJ6)
   04726 Serotonergic synapse
    3763 (KCNJ6)
   04723 Retrograde endocannabinoid signaling
    3763 (KCNJ6)
  Environmental adaptation
   04713 Circadian entrainment
    3763 (KCNJ6)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    3763 (KCNJ6)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   3763 (KCNJ6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
21q22.1
AA seq 423 aa AA seqDB search
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE
SKV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgacagaatccatgactaacgtcctggagggcgactccatggatcaggac
gtcgaaagcccagtggccattcaccagccaaagttgcctaagcaggccagggatgacctg
ccaagacacatcagccgagatcggaccaaaaggaaaatccagaggtacgtgaggaaagac
ggaaagtgcaatgttcatcacggcaacgtgagggagacctatcgctacctgaccgatatc
ttcaccacattagtggacctgaagtggagattcaacctattgatttttgtcatggtttac
acagtgacctggctcttttttggaatgatctggtggttgatcgcatacatacggggagac
atggaccacatagaggacccctcctggactccttgtgttaccaacctcaacgggttcgtc
tctgcttttttattctcaatagagacagaaaccaccattggttatggctaccgggtcatc
acagataaatgcccagagggaattattcttctcttaatccaatctgtgttggggtccatt
gtcaatgcattcatggtgggatgcatgtttgtaaaaatctctcaacccaagaagagggca
gagaccctggtcttttccacccatgcagtgatctccatgcgggatgggaaactgtgcctg
atgttccgggtaggggaccttaggaattcccacattgtggaggcttccatcagagccaag
ttgatcaaatccaaacagacctcggagggggagttcatcccgttgaaccagacggatatc
aacgtagggtattacacgggggatgaccgtctgtttctggtgtcaccgctgatcattagc
catgaaattaaccaacagagtcctttctgggagatctccaaagcccagctgcccaaagag
gaactggaaattgtggtcatcctagaaggaatggtggaagccacagggatgacatgccaa
gctcgaagctcctacatcaccagtgagatcctgtggggttaccggttcacacctgtcctg
accctggaggacgggttctacgaagttgactacaacagcttccatgagacctatgagacc
agcaccccatcccttagtgccaaagagctggccgagttagccagcagggcagagctgccc
ctgagttggtctgtatccagcaaactcaaccaacatgcagaactggagactgaagaggaa
gaaaagaacctcgaagagcaaacagaaagaaatggtgatgtggcaaacctggagaatgaa
tccaaagtttag

DBGET integrated database retrieval system