KEGG   Homo sapiens (human): 376497Help
Entry
376497            CDS       T01001                                 

Gene name
SLC27A1, ACSVL5, FATP, FATP1
Definition
solute carrier family 27 (fatty acid transporter), member 1
Orthology
K08745  
solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Class
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.11
AA seq 646 aa AA seqDB search
MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSV
LIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLF
RQLGFAPGDVVAIFLEGRPEFVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALI
FGGEMVAAVAEVSGHLGKSLIKFCSGDLGPEGILPDTHLLDPLLKEASTAPLAQIPSKGM
DDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIG
VGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVREAERRHRVRL
AVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIR
LVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSV
FSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVY
GVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQ
KTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctccgggtgcgggcgcggcctcggtggtctcgctggcgctgttgtggctgctg
gggctgccgtggacctggagcgcggcagcggcgctcggcgtgtacgtgggcagcggcggc
tggcgcttcctgcgcatcgtctgcaagaccgcgaggcgagacctcttcggtctctctgtg
ctgatccgcgtgcgcctggagctgcggcggcaccagcgtgccggccacaccatcccgcgc
atctttcaggcggtagtgcagcgacagcccgagcgcctggcgctggtggatgccgggacc
ggcgagtgctggacctttgcgcagctggacgcctactccaatgcggtagccaacctcttc
cgccagctgggcttcgcgccgggcgacgtggtggccatcttcctggagggccggccggag
ttcgtggggctgtggctgggcctggccaaggcgggcatggaggccgcgctgctcaacgtg
aacctgcggcgcgagcccctggccttctgcctgggcacctcgggcgctaaggccctgatc
tttggaggagaaatggtggcggcggtggccgaagtgagcgggcatctggggaaaagtttg
atcaagttctgctctggagacttggggcccgagggcatcttgccggacacccacctcctg
gacccgctgctgaaggaggcctctactgcccccttggcacagatccccagcaagggcatg
gacgatcgtcttttctacatctacacgtcggggaccaccgggctgcccaaggctgccatt
gtcgtgcacagcaggtactaccgcatggcagccttcggccaccacgcctaccgcatgcag
gcggctgacgtgctctatgactgcctgcccctgtaccactcggcaggaaacatcatcggc
gtggggcagtgtctcatctatgggctgacagtcgtcctccgcaagaaattctcggccagc
cgcttctgggacgactgcatcaagtacaactgcacggtggttcagtacatcggggagatc
tgccgctacctgctgaagcagccggtgcgcgaggcggagaggcgacaccgcgtgcgcctg
gcggtggggaacgggctgcgtcctgccatctgggaggagttcacggagcgcttcggcgta
cgccaaatcggggagttctacggcgccaccgagtgcaactgcagcattgccaacatggac
ggcaaggtcggctcctgtggtttcaacagccgcatcctgccccacgtgtaccccatccgg
ctggtgaaggtcaatgaggacacaatggagctgctgcgggatgcccagggcctctgcatc
ccctgccaggccggggagcctggcctccttgtgggtcagatcaaccaacaggacccgctg
cgccgcttcgatggctatgtcagcgagagcgccaccagcaagaagatcgcccacagcgtc
ttcagcaagggcgacagcgcctacctctcaggtgacgtgctagtgatggatgagctgggc
tacatgtacttccgggaccgtagcggggacaccttccgctggcgaggggagaacgtctcc
accaccgaggtggagggcgtgctgagccgcctgctgggccagacagacgtggccgtctat
ggggtggctgttccaggagtggagggtaaggcagggatggcggccgtcgcagacccccac
agcctgctggaccccaacgcgatataccaggagctgcagaaggtgctggcaccctatgcc
cggcccatcttcctgcgcctcctgccccaggtggacaccacaggcaccttcaagatccag
aagacgaggctgcagcgagagggctttgacccacgccagacctcagaccggctcttcttc
ctggacctgaagcagggccactacctgcccttaaatgaggcagtctacactcgcatctgc
tcgggcgccttcgccctctga

DBGET integrated database retrieval system