KEGG   Homo sapiens (human): 3765Help
Entry
3765              CDS       T01001                                 

Gene name
KCNJ9, GIRK3, KIR3.3
Definition
potassium inwardly-rectifying channel, subfamily J, member 9
Orthology
K05002  
potassium inwardly-rectifying channel subfamily J member 9
Organism
hsa  Homo sapiens (human)
Pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Serotonergic synapse
Dopaminergic synapse
Estrogen signaling pathway
Oxytocin signaling pathway
Morphine addiction
Class
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1q23.2
AA seq 393 aa AA seqDB search
MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggagaacgcggccttctcgcccgggcaggaggagccgccgcggcgccgcggc
cgccagcgctacgtggagaaggatggccggtgcaacgtgcagcagggcaacgtgcgcgag
acataccgctacctgacggacctgttcaccacgctggtggacctgcagtggcgcctcagc
ctgttgttcttcgtcctggcctacgcgctcacctggctcttcttcggcgccatctggtgg
ctgatcgcctacggccgcggcgacctggagcacctggaggacaccgcgtggacgccgtgc
gtcaacaacctcaacggcttcgtggccgccttcctcttctccatcgagaccgagaccacc
atcggctacgggcaccgcgtcatcaccgaccagtgccccgagggcatcgtgctgctgctg
ctgcaggccatcctgggctccatggtgaacgccttcatggtgggctgcatgttcgtcaag
atctcgcagcccaacaagcgcgcagccacgctcgtcttctcctcgcacgccgtggtgtcg
ctgcgcgacgggcgcctctgcctcatgttccgcgtgggcgacttgcgctcctcacacata
gtggaggcctccatccgcgccaagctcatccgctcgcgccagacgctggagggcgagttc
atcccgctgcaccagaccgacctcagcgtgggcttcgacacgggagacgaccgcctcttc
ctcgtctcgccgctggttatcagccacgagatcgacgccgccagccccttctgggaggcg
tcgcgccgtgccctcgagagggacgacttcgagatcgtcgttatcctcgagggcatggtg
gaagccacgggaatgacatgccaagctcggagctcctacctggtagacgaggtgctgtgg
ggccaccgcttcacgtcagtgctgactctggaggacggcttctacgaagtggactatgcc
agctttcacgagacttttgaggtgcccacaccttcgtgcagtgctcgagagctggcagag
gctgccgcccgccttgatgcccatctctactggtccatccccagccggctggatgagaag
gtggaggaggagggggcgggggagggggcgggtggggaagctggggctgacaaggagcag
aatggctgcctgccacccccagagagtgagtccaaggtgtga

DBGET integrated database retrieval system