KEGG   Homo sapiens (human): 3765Help
Entry
3765              CDS       T01001                                 

Gene name
KCNJ9, GIRK3, KIR3.3
Definition
potassium inwardly-rectifying channel, subfamily J, member 9
Orthology
K05002  
potassium inwardly-rectifying channel subfamily J member 9
Organism
hsa  Homo sapiens (human)
Pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Serotonergic synapse
Dopaminergic synapse
Estrogen signaling pathway
Oxytocin signaling pathway
Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    3765 (KCNJ9)
   04921 Oxytocin signaling pathway
    3765 (KCNJ9)
  Nervous system
   04728 Dopaminergic synapse
    3765 (KCNJ9)
   04726 Serotonergic synapse
    3765 (KCNJ9)
   04723 Retrograde endocannabinoid signaling
    3765 (KCNJ9)
  Environmental adaptation
   04713 Circadian entrainment
    3765 (KCNJ9)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    3765 (KCNJ9)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   3765 (KCNJ9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1q23.2
AA seq 393 aa AA seqDB search
MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggagaacgcggccttctcgcccgggcaggaggagccgccgcggcgccgcggc
cgccagcgctacgtggagaaggatggccggtgcaacgtgcagcagggcaacgtgcgcgag
acataccgctacctgacggacctgttcaccacgctggtggacctgcagtggcgcctcagc
ctgttgttcttcgtcctggcctacgcgctcacctggctcttcttcggcgccatctggtgg
ctgatcgcctacggccgcggcgacctggagcacctggaggacaccgcgtggacgccgtgc
gtcaacaacctcaacggcttcgtggccgccttcctcttctccatcgagaccgagaccacc
atcggctacgggcaccgcgtcatcaccgaccagtgccccgagggcatcgtgctgctgctg
ctgcaggccatcctgggctccatggtgaacgccttcatggtgggctgcatgttcgtcaag
atctcgcagcccaacaagcgcgcagccacgctcgtcttctcctcgcacgccgtggtgtcg
ctgcgcgacgggcgcctctgcctcatgttccgcgtgggcgacttgcgctcctcacacata
gtggaggcctccatccgcgccaagctcatccgctcgcgccagacgctggagggcgagttc
atcccgctgcaccagaccgacctcagcgtgggcttcgacacgggagacgaccgcctcttc
ctcgtctcgccgctggttatcagccacgagatcgacgccgccagccccttctgggaggcg
tcgcgccgtgccctcgagagggacgacttcgagatcgtcgttatcctcgagggcatggtg
gaagccacgggaatgacatgccaagctcggagctcctacctggtagacgaggtgctgtgg
ggccaccgcttcacgtcagtgctgactctggaggacggcttctacgaagtggactatgcc
agctttcacgagacttttgaggtgcccacaccttcgtgcagtgctcgagagctggcagag
gctgccgcccgccttgatgcccatctctactggtccatccccagccggctggatgagaag
gtggaggaggagggggcgggggagggggcgggtggggaagctggggctgacaaggagcag
aatggctgcctgccacccccagagagtgagtccaaggtgtga

DBGET integrated database retrieval system