KEGG   Homo sapiens (human): 3767Help
Entry
3767              CDS       T01001                                 

Gene name
KCNJ11, BIR, HHF2, IKATP, KIR6.2, PHHI, TNDM3
Definition
potassium inwardly-rectifying channel, subfamily J, member 11
Orthology
K05004  
potassium inwardly-rectifying channel subfamily J member 11
Organism
hsa  Homo sapiens (human)
Pathway
Insulin secretion
Type II diabetes mellitus
Disease
H00409  
Type II diabetes mellitus
H00512  
Permanent neonatal diabetes mellitus (PNDM)
H00513  
Transient neonatal diabetes mellitus (TNDM)
H01267  
Familial hyperinsulinemic hypoglycemia (HHF)
Drug target
Glibenclamide: 
Tolbutamide: 
Amiodarone: 
Tedisamil: 
Dronedarone: 
Nicorandil: 
Diazoxide: 
Minoxidil: 
Pinacidil: 
Bepridil: 
Tolbutamide: 
Other: 
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.1
AA seq 390 aa AA seqDB search
MLSRKGIIPEEYVLTRLAEDPAKPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDHSLLEALT
LASARGPLRKRSVPMAKAKPKFSISPDSLS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgcaagggcatcatccccgaggaatacgtgctgacacgcctggcagaggac
cctgccaagcccaggtaccgtgcccgccagcggagggcccgctttgtgtccaagaaaggc
aactgcaacgtggcccacaagaacatccgggagcagggccgcttcctgcaggacgtgttc
accacgctggtggacctcaagtggccacacacattgctcatcttcaccatgtccttcctg
tgcagctggctgctcttcgccatggcctggtggctcatcgccttcgcccacggtgacctg
gcccccagcgagggcactgctgagccctgtgtcaccagcatccactccttctcgtctgcc
ttccttttctccattgaggtccaagtgactattggctttggggggcgcatggtgactgag
gagtgcccactggccatcctgatcctcatcgtgcagaacatcgtggggctcatgatcaac
gccatcatgcttggctgcatcttcatgaagactgcccaagcccaccgcagggctgagacc
ctcatcttcagcaagcatgcggtgatcgccctgcgccacggccgcctctgcttcatgcta
cgtgtgggtgacctccgcaagagcatgatcatcagcgccaccatccacatgcaggtggta
cgcaagaccaccagccccgagggcgaggtggtgcccctccaccaggtggacatccccatg
gagaacggcgtgggtggcaacagcatcttcctggtggccccgctgatcatctaccatgtc
attgatgccaacagcccactctacgacctggcacccagcgacctgcaccaccaccaggac
ctcgagatcatcgtcatcctggaaggcgtggtggaaaccacgggcatcaccacccaggcc
cgcacctcctacctggccgatgagatcctgtggggccagcgctttgtgcccattgtagct
gaggaggacggacgttactctgtggactactccaagtttggcaacaccgtcaaagtgccc
acaccactctgcacggcccgccagcttgatgaggaccacagcctactggaagctctgacc
ctcgcctcagcccgcgggcccctgcgcaagcgcagcgtgcccatggccaaggccaagccc
aagttcagcatctctccagattccctgtcctga

DBGET integrated database retrieval system