KEGG   Homo sapiens (human): 3768Help
Entry
3768              CDS       T01001                                 

Gene name
KCNJ12, IRK-2, IRK2, KCNJN1, Kir2.2, Kir2.2v, hIRK, hIRK1, hkir2.2x, kcnj12x
Definition
potassium inwardly-rectifying channel, subfamily J, member 12
Orthology
K05005  
potassium inwardly-rectifying channel subfamily J member 12
Organism
hsa  Homo sapiens (human)
Pathway
Cholinergic synapse
Oxytocin signaling pathway
Drug target
Amiodarone: 
Bepridil: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    3768 (KCNJ12)
  Nervous system
   04725 Cholinergic synapse
    3768 (KCNJ12)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   3768 (KCNJ12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p11.2
AA seq 433 aa AA seqDB search
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG
VLEQRPYRRESEI
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggccagccgggccaacccctacagcatcgtgtcatcggaggaggacgggctg
cacctggtcaccatgtcgggcgccaacggcttcggcaacggcaaggtgcacacgcggcgc
aggtgccgcaaccgcttcgtcaagaagaatggccagtgcaacattgagttcgccaacatg
gacgagaagtcacagcgctacctggctgacatgttcaccacctgtgtggacatccgctgg
cggtacatgctgctcatcttctcgctggccttccttgcctcctggctgctgttcggcatc
atcttctgggtcatcgcggtggcacacggtgacctggagccggctgagggccggggccgc
acaccctgtgtgatgcaggtgcacggcttcatggcggccttcctcttctccatcgagacg
cagaccaccatcggctacgggctgcgctgtgtgacggaggagtgcccggtggccgtcttc
atggtggtggcccagtccatcgtgggctgcatcatcgactccttcatgattggtgccatc
atggccaagatggcaaggcccaagaagcgggcacagacgctgctgttcagccacaacgcc
gtggtggccctgcgtgacggcaagctctgcctcatgtggcgtgtgggtaacctgcgcaag
agccacattgtggaggcccatgtgcgcgcgcagctcatcaagccgcgggtcaccgaggag
ggcgagtacatcccgctggaccagatcgacatcgatgtgggcttcgacaagggcctggac
cgcatctttctggtgtcgcccatcaccatcttgcatgagattgacgaggccagcccgctc
ttcggcatcagccggcaggacctggagacggacgactttgagatcgtggtcatcctggaa
ggcatggtggaggccacagccatgaccacccaggcccgcagctcctacctggccaatgag
atcctgtggggtcaccgctttgagcccgtgctcttcgaggagaagaaccagtacaagatt
gactactcgcacttccacaagacctatgaggtgccctctacgccccgctgcagtgcgaag
gatctggtagagaacaagttcctgctgcccagcgccaactccttctgctacgagaacgag
ctggccttcctgagccgtgacgaggaggatgaggcggacggagaccaggacggccgaagc
cgggacggcctcagcccccaggccaggcatgactttgacagactccaggctggcggcggg
gtcctggagcagcggccctacagacgggagtcagagatctga

DBGET integrated database retrieval system