KEGG   Homo sapiens (human): 3769Help
Entry
3769              CDS       T01001                                 

Gene name
KCNJ13, KIR1.4, KIR7.1, LCA16, SVD
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 13
  KO
K05006  
potassium inwardly-rectifying channel subfamily J member 13
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Disease
H00805  
Vitreoretinal degeneration
H00837  
Leber congenital amaurosis (LCR)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    3769 (KCNJ13)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   3769 (KCNJ13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37
AA seq 360 aa AA seqDB search
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH
MDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSDECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggacagcagtaattgcaaagttattgctcctctcctaagtcaaagataccggaggatg
gtcaccaaggatggccacagcacacttcaaatggatggcgctcaaagaggtcttgcatat
cttcgagatgcttggggaatcctaatggacatgcgctggcgttggatgatgttggtcttt
tctgcttcttttgttgtccactggcttgtctttgcagtgctctggtatgttctggctgag
atgaatggtgatctggaactagatcatgatgccccacctgaaaaccacactatctgtgtc
aagtatatcaccagtttcacagctgcattctccttctccctggagacacaactcacaatt
ggttatggtaccatgttccccagtggtgactgtccaagtgcaatcgccttacttgccata
caaatgctcctaggcctcatgctagaggcttttatcacaggtgcttttgtggcgaagatt
gcccggccaaaaaatcgagctttttcaattcgctttactgacacagcagtagtagctcac
atggatggcaaacctaatcttatcttccaagtggccaacacccgacctagccctctaacc
agtgtccgggtctcagctgtactctatcaggaaagagaaaatggcaaactctaccagacc
agtgtggatttccaccttgatggcatcagttctgacgaatgtccattcttcatctttcca
ctaacgtactatcactccattacaccatcaagtcctctggctactctgctccagcatgaa
aatccttctcactttgaattagttgtattcctttcagcaatgcaggagggcactggagaa
atatgccaaaggaggacatcctacctaccgtctgaaatcatgttacatcactgttttgca
tctctgttgacccgaggttccaaaggtgaatatcaaatcaagatggagaattttgacaag
actgtccctgaatttccaactcctctggtttctaaaagcccaaacaggactgacctggat
atccacatcaatggacaaagcattgacaattttcagatctctgaaacaggactgacagaa
taa

DBGET integrated database retrieval system