KEGG   Homo sapiens (human): 3769Help
Entry
3769              CDS       T01001                                 

Gene name
KCNJ13, KIR1.4, KIR7.1, LCA16, SVD
Definition
potassium inwardly-rectifying channel, subfamily J, member 13
Orthology
K05006  
potassium inwardly-rectifying channel subfamily J member 13
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Disease
H00805  
Vitreoretinal degeneration
H00837  
Leber congenital amaurosis (LCR)
Class
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37
AA seq 94 aa AA seqDB search
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWCFCGEDCPAKKSSFFNSLY
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggacagcagtaattgcaaagttattgctcctctcctaagtcaaagataccggaggatg
gtcaccaaggatggccacagcacacttcaaatggatggcgctcaaagaggtcttgcatat
cttcgagatgcttggggaatcctaatggacatgcgctggcgttggatgatgttggtcttt
tctgcttcttttgttgtccactggcttgtctttgcagtgctctggtgcttttgtggcgaa
gattgcccggccaaaaaatcgagctttttcaattcgctttactga

DBGET integrated database retrieval system