KEGG   Homo sapiens (human): 3770Help
Entry
3770              CDS       T01001                                 

Gene name
KCNJ14, IRK4, KIR2.4
Definition
potassium inwardly-rectifying channel, subfamily J, member 14
Orthology
K05007  
potassium inwardly-rectifying channel subfamily J member 14
Organism
hsa  Homo sapiens (human)
Pathway
Cholinergic synapse
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    3770 (KCNJ14)
  Nervous system
   04725 Cholinergic synapse
    3770 (KCNJ14)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   3770 (KCNJ14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13
AA seq 436 aa AA seqDB search
MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA
ASPRVLTPTLALTLPP
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggccagggccctacgccgcctcagcggcgccctggattcgggagacagccgg
gcgggcgatgaagaggaggccgggcccgggttgtgccgcaacgggtgggcgccggcaccg
gtgcagtcacccgtgggccggcgccgcggtcgcttcgtcaagaaagacgggcactgcaac
gtgcgtttcgtaaacctgggtggccagggcgcgcgctacctgagcgacctgttcaccaca
tgcgtggacgtgcgctggcgctggatgtgcctgctcttctcctgctccttcctcgcctcc
tggctgctcttcggcctggccttctggctcattgcctcgctgcacggcgacctggccgcc
ccgccaccgcccgcgccctgcttctcacacgtggccagcttcctggccgccttcctcttc
gcgctggagacgcagacgtccatcggctacggcgtgcgcagcgtcaccgaggagtgcccg
gccgctgtggccgccgtggtgctgcagtgcattgccggctgcgtgctcgacgccttcgtc
gtgggtgctgtcatggccaagatggccaaacccaagaagcgcaacgagacgctggtcttc
agcgagaacgccgtcgtggcgctgcgcgaccaccgcctctgcctcatgtggcgcgtcggc
aacctgcgccgcagccacctggtcgaggcccacgtgcgtgcccagctgctgcagccccgt
gtgaccccagagggtgagtacatcccgctggaccaccaggatgtggatgtgggctttgat
ggaggcaccgatcgtatcttcctcgtgtcccccatcaccatcgtccatgagatcgactct
gccagtcctctgtatgagctaggacgtgccgagctggccagggctgactttgagctggtg
gtcattctcgaggggatggttgaggccacagccatgaccacacagtgtcgctcgtcctac
ctccctggtgaactgctctggggccatcgttttgagccagttctcttccagcgtggctcc
cagtatgaggtcgactatcgccacttccatcgcacttatgaggtcccagggacaccggtc
tgcagtgctaaggagctggatgaacgggcagagcaggcttcccacagcctcaagtctagt
ttccccggctctctgactgcattttgttatgagaatgaacttgctctgagctgctgccag
gaggaagatgaggacgatgagactgaggaagggaatggggtggaaacagaagatggggct
gctagcccccgagttctcacaccaaccctggcgctgaccctgcctccatga

DBGET integrated database retrieval system