KEGG   Homo sapiens (human): 3773Help
Entry
3773              CDS       T01001                                 

Gene name
KCNJ16, BIR9, KIR5.1
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 16
  KO
K05009  potassium inwardly-rectifying channel subfamily J member 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    3773 (KCNJ16)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   3773 (KCNJ16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 3773
NCBI-ProteinID: NP_001257351
OMIM: 605722
HGNC: 6262
Ensembl: ENSG00000153822
Vega: OTTHUMG00000180349
Pharos: Q9NPI9(Tbio)
UniProt: Q9NPI9
Position
17q24.3
AA seq 418 aa AA seqDB search
MSYYGSSYHIINADAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTG
AFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVR
ESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagctattacggcagcagctatcatattatcaatgcggacgcaaaatacccaggctac
ccgccagagcacattatagctgagaagagaagagcaagaagacgattacttcacaaagat
ggcagctgtaatgtctacttcaagcacatttttggagaatggggaagctatgtggttgac
atcttcaccactcttgtggacaccaagtggcgccatatgtttgtgatattttctttatct
tatattctctcgtggttgatatttggctctgtcttttggctcatagcctttcatcatggc
gatctattaaatgatccagacatcacaccttgtgttgacaacgtccattctttcacaggg
gcctttttgttctccctagagacccaaaccaccataggatatggttatcgctgtgttact
gaagaatgttctgtggccgtgctcatggtgatcctccagtccatcttaagttgcatcata
aatacctttatcattggagctgccttggccaaaatggcaactgctcgaaagagagcccaa
accattcgtttcagctactttgcacttataggtatgagagatgggaagctttgcctcatg
tggcgcattggtgattttcggccaaaccacgtggtagaaggaacagttagagcccaactt
ctccgctatacagaagacagtgaagggaggatgacgatggcatttaaagacctcaaatta
gtcaacgaccaaatcatcctggtcaccccggtaactattgtccatgaaattgaccatgag
agccctctgtatgcccttgaccgcaaagcagtagccaaagataactttgagattttggtg
acatttatctatactggtgattccactggaacatctcaccaatctagaagctcctatgtt
ccccgagaaattctctggggccataggtttaatgatgtcttggaagttaagaggaagtat
tacaaagtgaactgcttacagtttgaaggaagtgtggaagtatatgcccccttttgcagt
gccaagcaattggactggaaagaccagcagctccacatagaaaaagcaccaccagttcga
gaatcctgcacgtcggacaccaaggcgagacgaaggtcatttagtgcagttgccattgtc
agcagctgtgaaaaccctgaggagaccaccacttccgccacacatgaatatagggaaaca
ccttatcagaaagctctcctgactttaaacagaatctctgtagaatcccaaatgtag

DBGET integrated database retrieval system