KEGG   Homo sapiens (human): 3775Help
Entry
3775              CDS       T01001                                 

Gene name
KCNK1, DPK, HOHO, K2P1, K2p1.1, KCNO1, TWIK-1, TWIK1
Definition
(RefSeq) potassium two pore domain channel subfamily K member 1
  KO
K04912  
potassium channel subfamily K member 1
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   3775 (KCNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q42.2
AA seq 336 aa AA seqDB search
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK
RRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY
GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVA
IVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK
FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS
FSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagtccctggccggcagctcgtgcgtgcgcctggtggagcggcaccgctcggcc
tggtgcttcggcttcctggtgctgggctacttgctctacctggtcttcggcgcagtggtc
ttctcctcggtggagctgccctatgaggacctgctgcgccaggagctgcgcaagctgaag
cgacgcttcttggaggagcacgagtgcctgtctgagcagcagctggagcagttcctgggc
cgggtgctggaggccagcaactacggcgtgtcggtgctcagcaacgcctcgggcaactgg
aactgggacttcacctccgcgctcttcttcgccagcaccgtgctctccaccacaggttat
ggccacaccgtgcccttgtcagatggaggtaaggccttctgcatcatctactccgtcatt
ggcattcccttcaccctcctgttcctgacggctgtggtccagcgcatcaccgtgcacgtc
acccgcaggccggtcctctacttccacatccgctggggcttctccaagcaggtggtggcc
atcgtccatgccgtgctccttgggtttgtcactgtgtcctgcttcttcttcatcccggcc
gctgtcttctcagtcctggaggatgactggaacttcctggaatccttttatttttgtttt
atttccctgagcaccattggcctgggggattatgtgcctggggaaggctacaatcaaaaa
ttcagagagctctataagattgggatcacgtgttacctgctacttggccttattgccatg
ttggtagttctggaaaccttctgtgaactccatgagctgaaaaaattcagaaaaatgttc
tatgtgaagaaggacaaggacgaggatcaggtgcacatcatagagcatgaccaactgtcc
ttctcctcgatcacagaccaggcagctggcatgaaagaggaccagaagcaaaatgagcct
tttgtggccacccagtcatctgcctgcgtggatggccctgcaaaccattga

DBGET integrated database retrieval system