KEGG   Homo sapiens (human): 3776Help
Entry
3776              CDS       T01001                                 

Gene name
KCNK2, K2p2.1, TPKC1, TREK, TREK-1, TREK1, hTREK-1c, hTREK-1e
Definition
(RefSeq) potassium two pore domain channel subfamily K member 2
  KO
K04913  
potassium channel subfamily K member 2
Organism
hsa  Homo sapiens (human)
Pathway
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    3776 (KCNK2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   3776 (KCNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q41
AA seq 426 aa AA seqDB search
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA
VIENIK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccagcgcctcgcgggagagacccggctatagagcaggagtggcggcacctgac
ttgctggatcctaaatctgccgctcagaactccaaaccgaggctctcgttttccacgaaa
cccacagtgcttgcttcccgggtggagagtgacacgaccattaatgttatgaaatggaag
acggtctccacgatattcctggtggttgtcctctatctgatcatcggagccaccgtgttc
aaagcattggagcagcctcatgagatttcacagaggaccaccattgtgatccagaagcaa
acattcatatcccaacattcctgtgtcaattcgacggagctggatgaactcattcagcaa
atagtggcagcaataaatgcagggattataccgttaggaaacacctccaatcaaatcagt
cactgggatttgggaagttccttcttctttgctggcactgttattacaaccataggattt
ggaaacatctcaccacgcacagaaggcggcaaaatattctgtatcatctatgccttactg
ggaattcccctctttggttttctcttggctggagttggagatcagctaggcaccatattt
ggaaaaggaattgccaaagtggaagatacgtttattaagtggaatgttagtcagaccaag
attcgcatcatctcaacaatcatatttatactatttggctgtgtactctttgtggctctg
cctgcgatcatattcaaacacatagaaggctggagtgccctggacgccatttattttgtg
gttatcactctaacaactattggatttggtgactacgttgcaggtggatccgatattgaa
tatctggacttctataagcctgtcgtgtggttctggatccttgtagggcttgcttacttt
gctgctgtcctgagcatgattggagattggctccgagtgatatctaaaaagacaaaagaa
gaggtgggagagttcagagcacacgctgctgagtggacagccaacgtcacagccgaattc
aaagaaaccaggaggcgactgagtgtggagatttatgacaagttccagcgggccacctcc
atcaagcggaagctctcggcagaactggctggaaaccacaatcaggagctgactccttgt
aggaggaccctgtcagtgaaccacctgaccagcgagagggatgtcttgcctcccttactg
aagactgagagtatctatctgaatggtttgacgccacactgtgctggtgaagagattgct
gtgattgagaacatcaaatag

DBGET integrated database retrieval system