KEGG   Homo sapiens (human): 377630Help
Entry
377630            CDS       T01001                                 

Gene name
USP17L2, DUB-3, DUB3, USP17
Definition
ubiquitin specific peptidase 17-like family member 2 (EC:3.4.19.12)
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     377630 (USP17L2)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   377630 (USP17L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p23.1
AA seq 530 aa AA seqDB search
MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSSEARVDLCDDLAPVAR
QLAPRKKLPLSSRRPAAVGAGLQNMGNTCYENASLQCLTYTPPLANYMLSREHSQTCQRP
KCCMLCTMQAHITWALHSPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMKKACLPGH
KQVDHHSKDTTLIHQIFGGCWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVKQALEQL
VKPEELNGENAYHCGLCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGNKLAKNVQYPEC
LDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHDGHYFSYVKAQEGQWYKMDDAKVTACSIT
SVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
DERLVERATQESTLDHWKFPQEQNKTKPEFNVRKVEGTLPPNVLVIHQSKYKCGMKNHHP
EQQSSLLNLSSTTRTDQESVNTGTLASLQGRTRRSKGKNKHSKRALLVCQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgactcactctacttgggaggtgagtggcagttcaaccacttttcaaaactc
acatcttctcggccagatgcagcttttgctgaaatccagcggacttctctccctgagaag
tcaccactctcatctgaggcccgtgtcgacctctgtgatgatttggctcctgtggcaaga
cagcttgctcccaggaagaagcttcctctgagtagcaggagacctgctgcggtgggggct
gggctccagaatatgggaaatacctgctacgagaacgcttccctgcagtgcctgacatac
acaccgccccttgccaactacatgctgtcccgggagcactctcaaacatgtcagcgtccc
aagtgctgcatgctctgtactatgcaagctcacatcacatgggccctccacagtcctggt
catgtcatccagccctcacaggcattggctgctggcttccatagaggcaagcaggaagat
gcccatgaatttctcatgttcactgtggatgccatgaaaaaggcatgccttcccggccac
aagcaggtagatcatcactctaaggacaccaccctcatccaccaaatatttggaggctgc
tggagatctcaaatcaagtgtctccactgccacgggatttcagacacttttgacccttac
ctggacatcgccctggatatccaggcagctcagagtgtcaagcaagctttggaacagttg
gtgaagcccgaagaactcaatggagagaatgcctatcattgcggtctttgtctccagagg
gcgccggcctccaagacgttaactttacacacttctgccaaggtcctcatccttgtcttg
aagagattctccgatgtcacaggcaacaaacttgccaagaatgtgcaatatcctgagtgc
cttgacatgcagccatacatgtctcagcagaacacaggacctcttgtctatgtcctctat
gctgtgctggtccacgctgggtggagttgtcacgacggacattacttctcttatgtcaaa
gctcaagaaggccagtggtataaaatggatgatgccaaggtcactgcctgtagcatcact
tctgtcctgagtcaacaggcctatgtcctcttttacatccagaagagtgaatgggaaaga
cacagtgagagtgtgtcaagaggcagggaaccaagagccctcggcgctgaagacacagac
aggcgagcaacgcaaggagagctcaagagagaccacccctgcctccaggcacccgagttg
gacgagcgcttggtggaaagagccactcaggaaagcaccttagaccactggaaattcccc
caagagcaaaacaaaacgaagcctgagttcaacgtcagaaaagtcgaaggtaccctgcct
cccaacgtacttgtgattcatcaatcgaaatacaagtgtgggatgaaaaaccatcatcct
gaacagcaaagctccctgctaaacctctcttcgacgacccggacagatcaggagtccgtg
aacactggcaccctcgcttctctgcaagggaggaccaggagatccaaagggaagaacaaa
cacagcaagagggctctgcttgtgtgccagtga

DBGET integrated database retrieval system