KEGG   Homo sapiens (human): 3777Help
Entry
3777              CDS       T01001                                 

Gene name
KCNK3, K2p3.1, OAT1, PPH4, TASK, TASK-1, TBAK1
Definition
(RefSeq) potassium two pore domain channel subfamily K member 3
  KO
K04914  
potassium channel subfamily K member 3
Organism
hsa  Homo sapiens (human)
Pathway
Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    3777 (KCNK3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   3777 (KCNK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
2p23
AA seq 394 aa AA seqDB search
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRR
CLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcagaacgtgcgcacgctggcgctcatcgtgtgcaccttcacctacctgctg
gtgggcgccgcggtcttcgacgcgctggagtcggagcccgagctgatcgagcggcagcgg
ctggagctgcggcagcaggagctgcgggcgcgctacaacctcagccagggcggctacgag
gagctggagcgcgtcgtgctgcgcctcaagccgcacaaggccggcgtgcagtggcgcttc
gccggctccttctacttcgccatcaccgtcatcaccaccatcggctacgggcacgcggca
cccagcacggatggcggcaaggtgttctgcatgttctacgcgctgctgggcatcccgctc
acgctcgtcatgttccagagcctgggcgagcgcatcaacaccttggtgaggtacctgctg
caccgcgccaagaaggggctgggcatgcggcgcgccgacgtgtccatggccaacatggtg
ctcatcggcttcttctcgtgcatcagcacgctgtgcatcggcgccgccgccttctcccac
tacgagcactggaccttcttccaggcctactactactgcttcatcaccctcaccaccatc
ggcttcggcgactacgtggcgctgcagaaggaccaggccctgcagacgcagccgcagtac
gtggccttcagcttcgtctacatccttacgggcctcacggtcatcggcgccttcctcaac
ctcgtggtgctgcgcttcatgaccatgaacgccgaggacgagaagcgcgacgccgagcac
cgcgcgctgctcacgcgcaacgggcaggcgggcggcggcggagggggtggcagcgcgcac
actacggacaccgcctcatccacggcggcagcgggcggcggcggcttccgcaacgtctac
gcggaggtgctgcacttccagtccatgtgctcgtgcctgtggtacaagagccgcgagaag
ctgcagtactccatccccatgatcatcccgcgggacctctccacgtccgacacgtgcgtg
gagcagagccactcgtcgccgggagggggcggccgctacagcgacacgccctcgcgacgc
tgcctgtgcagcggggcgccacgctccgccatcagctcggtgtccacgggtctgcacagc
ctgtccaccttccgcggcctcatgaagcgcaggagctccgtgtga

DBGET integrated database retrieval system