KEGG   Homo sapiens (human): 3779Help
Entry
3779              CDS       T01001                                 

Gene name
KCNMB1, BKbeta1, K(VCA)beta, SLO-BETA, hbeta1, hslo-beta, k(VCA)beta-1, slo-beta-1
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 1
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    3779 (KCNMB1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    3779 (KCNMB1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    3779 (KCNMB1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   3779 (KCNMB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
5q34
AA seq 191 aa AA seqDB search
MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNI
RDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADV
EKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKS
NQYLSILAAQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaagctggtgatggcccagaagcggggagagacacgagccctttgcctgggt
gtaaccatggtggtgtgtgccgtcatcacctactacatcctggtcacgactgtgctgccc
ctctaccagaaaagcgtgtggacccaggaatccaagtgccacctgattgagaccaacatc
agggaccaggaggagctgaagggcaagaaggtgccccagtacccatgcctgtgggtcaac
gtgtcagctgccggcaggtgggctgtgctgtaccacacggaggacactcgggaccagaac
cagcagtgctcctacatcccaggcagcgtggacaattaccagacggcccgggccgacgtg
gagaaggtcagagccaaattccaagagcagcaggtcttctactgcttctccgcacctcgg
gggaacgaaaccagcgtcctattccagcgcctctacgggccccaggccctcctcttctcc
ctcttctggcccaccttcctgctgaccggtggcctcctcattatcgccatggtgaagagc
aaccagtacctgtccatcctggcggcccagaagtag

DBGET integrated database retrieval system