KEGG   Homo sapiens (human): 3780Help
Entry
3780              CDS       T01001                                 

Gene name
KCNN1, KCa2.1, SK1, SKCA1, hSK1
Definition
potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1
Orthology
K04942  
potassium intermediate/small conductance calcium-activated channel subfamily N member 1
Organism
hsa  Homo sapiens (human)
Pathway
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19p13.1
AA seq 543 aa AA seqDB search
MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPR
GQPQDQDDDEDDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVV
MVTETELSWGVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIA
MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEA
RLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPS
DCG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccacagctacaatggcagcgtggggcggccgctgggcagcgggccgggcgcc
ctgggacgagaccctccggaccctgaggccggccaccccccacaacccccgcacagcccg
ggcctccaggtggtagtggccaagagtgagccagcccggccctcacccggcagcccccgg
gggcagccccaggaccaggacgatgacgaggatgatgaggaagatgaggccggcaggcag
agagcctcggggaaaccctcaaatgtgggccaccgcctgggccaccggcgggcgctcttc
gagaagcggaagcgcctcagcgactatgccctcattttcggcatgtttggcatcgtcgtc
atggtgacggagaccgagctgtcctggggggtgtacaccaaggagtctctgtactcattc
gcactcaaatgcctcatcagcctctccacggccatcctgctgggtctcgttgtcctctac
catgcccgggagatccagctgttcatggtggacaacggggctgatgactggcgcatcgcc
atgacctgcgagcgcgtgttcctcatctcgctagagctggcagtgtgcgccattcacccg
gtgcccggccactaccgcttcacgtggacggcgcggctggccttcacgtacgcgccctcg
gtggccgaggccgacgtggacgtgctgctgtccatccccatgttcctgcgcctctacctg
ctgggccgggtgatgctactgcacagcaaaatcttcacggacgcctcgagccgcagcatc
ggggccctcaacaagatcaccttcaacacgcgcttcgtcatgaagacactcatgaccatc
tgccccggcaccgtgctgctggtcttcagcatctcctcctggatcatcgcagcctggacc
gtgcgcgtctgcgagaggtaccacgacaagcaggaagtgaccagcaacttcctgggggcc
atgtggctgatttccatcaccttcctctccattggctacggcgacatggtgccccacacc
tactgcgggaagggtgtgtgcctgctcactggcatcatgggagctggctgtaccgcgctc
gtggtggctgtggtggctcggaagctggagctcaccaaggctgagaagcacgtgcacaac
ttcatgatggacactcagctcaccaagcgggtaaaaaacgccgctgctaacgttctcagg
gagacgtggctcatctacaaacataccaggctggtgaagaagccagaccaagcccgggtt
cggaaacaccagcgtaagttcctccaagccatccatcaggctcagaagctccggagtgtg
aagatcgagcaagggaagctgaacgaccaggctaacacgcttaccgacctagccaagacc
cagaccgtcatgtacgaccttgtatcggagctgcacgctcagcacgaggagctggaggcc
cgcctggccaccctggaaagccgcttggatgcgctgggtgcctctctacaggccctgcct
ggcctcatcgcccaagccatacgcccacccccgcctcccctgcctcccaggcccggcccc
ggcccccaagaccaggcagcccggagctccccctgccggtggacgcccgtggccccctcg
gactgcgggtga

DBGET integrated database retrieval system