KEGG   Homo sapiens (human): 3781Help
Entry
3781              CDS       T01001                                 

Gene name
KCNN2, KCa2.2, SK2, SKCA2, SKCa_2, hSK2
Definition
(RefSeq) potassium calcium-activated channel subfamily N member 2
  KO
K04943  
potassium intermediate/small conductance calcium-activated channel subfamily N member 2
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Insulin secretion
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    3781 (KCNN2)
  Digestive system
   04976 Bile secretion
    3781 (KCNN2)
  Nervous system
   04726 Serotonergic synapse
    3781 (KCNN2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNN, KCa2-3.x (Small conductance)
   3781 (KCNN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q22.3
AA seq 579 aa AA seqDB search
MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAVS
SSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIGYK
LGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTII
LLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTAR
LAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRF
VMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIG
YGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVK
NAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLV
DLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFI
EAQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctgcaggtacaacgggggcgtcatgcggccgctcagcaacttgagcgcgtcc
cgccggaacctgcacgagatggactcagaggcgcagcccctgcagccccccgcgtctgtc
ggaggaggtggcggcgcgtcctccccgtctgcagccgctgccgccgccgccgctgtttcg
tcctcagcccccgagatcgtggtgtctaagcccgagcacaacaactccaacaacctggcg
ctctatggaaccggcggcggaggcagcactggaggaggcggcggcggtggcgggagcggg
cacggcagcagcagtggcaccaagtccagcaaaaagaaaaaccagaacatcggctacaag
ctgggccaccggcgcgccctgttcgaaaagcgcaagcggctcagcgactacgcgctcatc
ttcggcatgttcggcatcgtggtcatggtcatcgagaccgagctgtcgtggggcgcctac
gacaaggcgtcgctgtattccttagctctgaaatgccttatcagtctctccacgatcatc
ctgctcggtctgatcatcgtgtaccacgccagggaaatacagttgttcatggtggacaat
ggagcagatgactggagaatagccatgacttatgagcgtattttcttcatctgcttggaa
atactggtgtgtgctattcatcccatacctgggaattatacattcacatggacggcccgg
cttgccttctcctatgccccatccacaaccaccgctgatgtggatattattttatctata
ccaatgttcttaagactctatctgattgccagagtcatgcttttacatagcaaacttttc
actgatgcctcctctagaagcattggagcacttaataagataaacttcaatacacgtttt
gttatgaagactttaatgactatatgcccaggaactgtactcttggtttttagtatctca
ttatggataattgccgcatggactgtccgagcttgtgaaaggtaccatgatcaacaggat
gttactagcaacttccttggagcgatgtggttgatatcaataacttttctctccattggt
tatggtgacatggtacctaacacatactgtggaaaaggagtctgcttacttactggaatt
atgggtgctggttgcacagccctggtggtagctgtagtggcaaggaagctagaacttacc
aaagcagaaaaacacgtgcacaatttcatgatggatactcagctgactaaaagagtaaaa
aatgcagctgccaatgtactcagggaaacatggctaatttacaaaaatacaaagctagtg
aaaaagatagatcatgcaaaagtaagaaaacatcaacgaaaattcctgcaagctattcat
caattaagaagtgtaaaaatggagcagaggaaactgaatgaccaagcaaacactttggtg
gacttggcaaagacccagaacatcatgtatgatatgatttctgacttaaacgaaaggagt
gaagacttcgagaagaggattgttaccctggaaacaaaactagagactttgattggtagc
atccacgccctccctgggctcataagccagaccatcaggcagcagcagagagatttcatt
gaggctcagatggagagctacgacaagcacgtcacttacaatgctgagcggtcccggtcc
tcgtccaggaggcggcggtcctcttccacagcaccaccaacttcatcagagagtagctag

DBGET integrated database retrieval system