KEGG   Homo sapiens (human): 3781Help
Entry
3781              CDS       T01001                                 

Gene name
KCNN2, KCa2.2, SK2, SKCA2, SKCa_2, hSK2
Definition
potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2
Orthology
K04943  
potassium intermediate/small conductance calcium-activated channel subfamily N member 2
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Insulin secretion
Bile secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q22.3
AA seq 231 aa AA seqDB search
MWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHN
FMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKME
QRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLI
SQTIRQQQRDFIEAQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgatatcaataacttttctctccattggttatggtgacatggtacctaacaca
tactgtggaaaaggagtctgcttacttactggaattatgggtgctggttgcacagccctg
gtggtagctgtagtggcaaggaagctagaacttaccaaagcagaaaaacacgtgcacaat
ttcatgatggatactcagctgactaaaagagtaaaaaatgcagctgccaatgtactcagg
gaaacatggctaatttacaaaaatacaaagctagtgaaaaagatagatcatgcaaaagta
agaaaacatcaacgaaaattcctgcaagctattcatcaattaagaagtgtaaaaatggag
cagaggaaactgaatgaccaagcaaacactttggtggacttggcaaagacccagaacatc
atgtatgatatgatttctgacttaaacgaaaggagtgaagacttcgagaagaggattgtt
accctggaaacaaaactagagactttgattggtagcatccacgccctccctgggctcata
agccagaccatcaggcagcagcagagagatttcattgaggctcagatggagagctacgac
aagcacgtcacttacaatgctgagcggtcccggtcctcgtccaggaggcggcggtcctct
tccacagcaccaccaacttcatcagagagtagctag

DBGET integrated database retrieval system